NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|45551141|ref|NP_726095|]
View 

uncharacterized protein Dmel_CG10082, isoform A [Drosophila melanogaster]

Protein Classification

IPK domain-containing protein (domain architecture ID 10510190)

IPK domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IPK pfam03770
Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol ...
303-448 2.24e-64

Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol polyphosphate kinase.


:

Pssm-ID: 309046  Cd Length: 189  Bit Score: 215.88  E-value: 2.24e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141   303 FLMLENITSQFRNPCILDLKMGTRQHGDDASAEKRSKQMAKCAASTSGSLGVRLCGMQTYLADLEQYAKRDKYWGRELNE 382
Cdd:pfam03770   1 YILLEDLTAGFKKPCVLDLKMGTRQYGDDASEEKRKRQQKKCRETTSASLGFRICGMKVWNVDEDGYIFRDKYYGRSLSA 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 45551141   383 GGFKTALHDFFHNGYRLR--IRVIRKILQRLLQLRRVIEKQSSYRFYSCSLLIVYEGFEENPMAPPPS 448
Cdd:pfam03770  81 EEFKEALKRFFSNGKSLRrkKKIIPRFLERLQELRNVLESQESYRFYSSSLLFVYDGDPESDEEDPPP 148
IPK super family cl12283
Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol ...
846-894 1.54e-06

Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol polyphosphate kinase.


The actual alignment was detected with superfamily member pfam03770:

Pssm-ID: 325222  Cd Length: 189  Bit Score: 49.47  E-value: 1.54e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 45551141   846 VDVRLIDFAHTafvprngtmLPTPAAAPVHHGPDGGFLTGLDSLNRLLN 894
Cdd:pfam03770 150 VKVKLIDFAHT---------VPLPDGPWPGGGPDEGYLFGLRSLIKILE 189
 
Name Accession Description Interval E-value
IPK pfam03770
Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol ...
303-448 2.24e-64

Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol polyphosphate kinase.


Pssm-ID: 309046  Cd Length: 189  Bit Score: 215.88  E-value: 2.24e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141   303 FLMLENITSQFRNPCILDLKMGTRQHGDDASAEKRSKQMAKCAASTSGSLGVRLCGMQTYLADLEQYAKRDKYWGRELNE 382
Cdd:pfam03770   1 YILLEDLTAGFKKPCVLDLKMGTRQYGDDASEEKRKRQQKKCRETTSASLGFRICGMKVWNVDEDGYIFRDKYYGRSLSA 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 45551141   383 GGFKTALHDFFHNGYRLR--IRVIRKILQRLLQLRRVIEKQSSYRFYSCSLLIVYEGFEENPMAPPPS 448
Cdd:pfam03770  81 EEFKEALKRFFSNGKSLRrkKKIIPRFLERLQELRNVLESQESYRFYSSSLLFVYDGDPESDEEDPPP 148
PLN02667 PLN02667
inositol polyphosphate multikinase
183-437 1.61e-24

inositol polyphosphate multikinase


Pssm-ID: 215359  Cd Length: 286  Bit Score: 105.96  E-value: 1.61e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141  183 LHPLSNQVGGH----TRL--LLLNQSTVIKPLNL-----RELDFYQ------NIPQDILKFVPKYKGVMQATTMGGAKLd 245
Cdd:PLN02667   2 LKVPEHQVAGHrasdGKLgpLVDDSGRFYKPLQDdsrgeREAAFYEsfssdtRVPDHIRRFFPVFHGTQLVEASDGSGL- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141  246 kryspsfrddaaavpvrkmsaskrkrdevlrmkvhkngqaaeviksisqldntnkqyfLMLENITSQFRNPCILDLKMGT 325
Cdd:PLN02667  81 ----------------------------------------------------------LVLEDLLAGYTKPCVMDVKMGS 102
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141  326 RQHGDDASAEKRSKQMAKCAASTSGSLGVRLCGMQTYLADLEQYAKRDKYWGRELNEGGFKTALHDFFHNG--------Y 397
Cdd:PLN02667 103 RTWYPEASEEYIQKCLKKDRETTTVSLGFRVSGFKVYDHKESEFWKAERKLVKGLDADGVRLALRKFVSSNspadpnpdC 182
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 45551141  398 RLRIRVIR---KILQRLLQLRRVIEKQSSYRFYSCSLLIVYEG 437
Cdd:PLN02667 183 AFASAVYGgshGILAQLLELKSWFEEQTLYHFFSASILIVYEG 225
IPK pfam03770
Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol ...
846-894 1.54e-06

Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol polyphosphate kinase.


Pssm-ID: 309046  Cd Length: 189  Bit Score: 49.47  E-value: 1.54e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 45551141   846 VDVRLIDFAHTafvprngtmLPTPAAAPVHHGPDGGFLTGLDSLNRLLN 894
Cdd:pfam03770 150 VKVKLIDFAHT---------VPLPDGPWPGGGPDEGYLFGLRSLIKILE 189
 
Name Accession Description Interval E-value
IPK pfam03770
Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol ...
303-448 2.24e-64

Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol polyphosphate kinase.


Pssm-ID: 309046  Cd Length: 189  Bit Score: 215.88  E-value: 2.24e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141   303 FLMLENITSQFRNPCILDLKMGTRQHGDDASAEKRSKQMAKCAASTSGSLGVRLCGMQTYLADLEQYAKRDKYWGRELNE 382
Cdd:pfam03770   1 YILLEDLTAGFKKPCVLDLKMGTRQYGDDASEEKRKRQQKKCRETTSASLGFRICGMKVWNVDEDGYIFRDKYYGRSLSA 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 45551141   383 GGFKTALHDFFHNGYRLR--IRVIRKILQRLLQLRRVIEKQSSYRFYSCSLLIVYEGFEENPMAPPPS 448
Cdd:pfam03770  81 EEFKEALKRFFSNGKSLRrkKKIIPRFLERLQELRNVLESQESYRFYSSSLLFVYDGDPESDEEDPPP 148
PLN02667 PLN02667
inositol polyphosphate multikinase
183-437 1.61e-24

inositol polyphosphate multikinase


Pssm-ID: 215359  Cd Length: 286  Bit Score: 105.96  E-value: 1.61e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141  183 LHPLSNQVGGH----TRL--LLLNQSTVIKPLNL-----RELDFYQ------NIPQDILKFVPKYKGVMQATTMGGAKLd 245
Cdd:PLN02667   2 LKVPEHQVAGHrasdGKLgpLVDDSGRFYKPLQDdsrgeREAAFYEsfssdtRVPDHIRRFFPVFHGTQLVEASDGSGL- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141  246 kryspsfrddaaavpvrkmsaskrkrdevlrmkvhkngqaaeviksisqldntnkqyfLMLENITSQFRNPCILDLKMGT 325
Cdd:PLN02667  81 ----------------------------------------------------------LVLEDLLAGYTKPCVMDVKMGS 102
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45551141  326 RQHGDDASAEKRSKQMAKCAASTSGSLGVRLCGMQTYLADLEQYAKRDKYWGRELNEGGFKTALHDFFHNG--------Y 397
Cdd:PLN02667 103 RTWYPEASEEYIQKCLKKDRETTTVSLGFRVSGFKVYDHKESEFWKAERKLVKGLDADGVRLALRKFVSSNspadpnpdC 182
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 45551141  398 RLRIRVIR---KILQRLLQLRRVIEKQSSYRFYSCSLLIVYEG 437
Cdd:PLN02667 183 AFASAVYGgshGILAQLLELKSWFEEQTLYHFFSASILIVYEG 225
IPK pfam03770
Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol ...
846-894 1.54e-06

Inositol polyphosphate kinase; ArgRIII has has been demonstrated to be an inositol polyphosphate kinase.


Pssm-ID: 309046  Cd Length: 189  Bit Score: 49.47  E-value: 1.54e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 45551141   846 VDVRLIDFAHTafvprngtmLPTPAAAPVHHGPDGGFLTGLDSLNRLLN 894
Cdd:pfam03770 150 VKVKLIDFAHT---------VPLPDGPWPGGGPDEGYLFGLRSLIKILE 189
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH