NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4507065|ref|NP_003055|]
View 

antileukoproteinase precursor [Homo sapiens]

Protein Classification

WAP domain-containing protein (domain architecture ID 10442878)

WAP domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WAP smart00217
Four-disulfide core domains;
85-130 1.06e-09

Four-disulfide core domains;


:

Pssm-ID: 197580  Cd Length: 47  Bit Score: 51.60  E-value: 1.06e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 4507065      85 KPGKCP-VTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPV 130
Cdd:smart00217   1 KPGSCPwPTIASCPLGNPPNKCSSDSQCPGVKKCCFNGCGKSCLTPV 47
WAP pfam00095
WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or ...
31-73 2.37e-05

WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or elastase-specific inhibitors.


:

Pssm-ID: 306578  Cd Length: 44  Bit Score: 39.08  E-value: 2.37e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 4507065     31 KAGVCPPKKSAQCLRYK-KPECQSDWQCPGKKRCCPDTCGIKCL 73
Cdd:pfam00095   1 KPGVCPPPPLSCVPGGIcLDECSSDSDCPGGQKCCSNGCGRVCV 44
 
Name Accession Description Interval E-value
WAP smart00217
Four-disulfide core domains;
85-130 1.06e-09

Four-disulfide core domains;


Pssm-ID: 197580  Cd Length: 47  Bit Score: 51.60  E-value: 1.06e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 4507065      85 KPGKCP-VTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPV 130
Cdd:smart00217   1 KPGSCPwPTIASCPLGNPPNKCSSDSQCPGVKKCCFNGCGKSCLTPV 47
WAP cd00199
whey acidic protein-type four-disulfide core domains. Members of the family include whey ...
80-130 2.44e-07

whey acidic protein-type four-disulfide core domains. Members of the family include whey acidic protein, elafin (elastase-specific inhibitor), caltrin-like protein (a calcium transport inhibitor) and other extracellular proteinase inhibitors. A group of proteins containing 8 characteristically-spaced cysteine residuesforming disulphide bonds, have been termed '4-disulphide core' proteins. Protease inhibition occurs by insertion of the inhibitory loop into the active site pocket and interference with the catalytic residues of the protease.


Pssm-ID: 238120  Cd Length: 60  Bit Score: 45.13  E-value: 2.44e-07
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4507065   80 NPTRRKPGKCPV---TYGQCLMLN------PPNFCEMDGQCKRDLKCCMGMCGKSCVSPV 130
Cdd:cd00199   1 GNNMTKPGSCPRpveKPGRCPMVNppslgiPPNRCSSDSDCPGDKKCCENGCGKSCLTPV 60
WAP pfam00095
WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or ...
31-73 2.37e-05

WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or elastase-specific inhibitors.


Pssm-ID: 306578  Cd Length: 44  Bit Score: 39.08  E-value: 2.37e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 4507065     31 KAGVCPPKKSAQCLRYK-KPECQSDWQCPGKKRCCPDTCGIKCL 73
Cdd:pfam00095   1 KPGVCPPPPLSCVPGGIcLDECSSDSDCPGGQKCCSNGCGRVCV 44
WAP pfam00095
WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or ...
85-127 6.72e-05

WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or elastase-specific inhibitors.


Pssm-ID: 306578  Cd Length: 44  Bit Score: 37.92  E-value: 6.72e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 4507065     85 KPGKCPVTYGQCLM-LNPPNFCEMDGQCKRDLKCCMGMCGKSCV 127
Cdd:pfam00095   1 KPGVCPPPPLSCVPgGICLDECSSDSDCPGGQKCCSNGCGRVCV 44
WAP smart00217
Four-disulfide core domains;
31-76 1.35e-04

Four-disulfide core domains;


Pssm-ID: 197580  Cd Length: 47  Bit Score: 37.35  E-value: 1.35e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 4507065      31 KAGVCPPKKSAQC-LRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPV 76
Cdd:smart00217   1 KPGSCPWPTIASCpLGNPPNKCSSDSQCPGVKKCCFNGCGKSCLTPV 47
WAP cd00199
whey acidic protein-type four-disulfide core domains. Members of the family include whey ...
31-76 1.85e-03

whey acidic protein-type four-disulfide core domains. Members of the family include whey acidic protein, elafin (elastase-specific inhibitor), caltrin-like protein (a calcium transport inhibitor) and other extracellular proteinase inhibitors. A group of proteins containing 8 characteristically-spaced cysteine residuesforming disulphide bonds, have been termed '4-disulphide core' proteins. Protease inhibition occurs by insertion of the inhibitory loop into the active site pocket and interference with the catalytic residues of the protease.


Pssm-ID: 238120  Cd Length: 60  Bit Score: 34.35  E-value: 1.85e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 4507065   31 KAGVCPpKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPV 76
Cdd:cd00199  16 KPGRCP-MVNPPSLGIPPNRCSSDSDCPGDKKCCENGCGKSCLTPV 60
 
Name Accession Description Interval E-value
WAP smart00217
Four-disulfide core domains;
85-130 1.06e-09

Four-disulfide core domains;


Pssm-ID: 197580  Cd Length: 47  Bit Score: 51.60  E-value: 1.06e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 4507065      85 KPGKCP-VTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPV 130
Cdd:smart00217   1 KPGSCPwPTIASCPLGNPPNKCSSDSQCPGVKKCCFNGCGKSCLTPV 47
WAP cd00199
whey acidic protein-type four-disulfide core domains. Members of the family include whey ...
80-130 2.44e-07

whey acidic protein-type four-disulfide core domains. Members of the family include whey acidic protein, elafin (elastase-specific inhibitor), caltrin-like protein (a calcium transport inhibitor) and other extracellular proteinase inhibitors. A group of proteins containing 8 characteristically-spaced cysteine residuesforming disulphide bonds, have been termed '4-disulphide core' proteins. Protease inhibition occurs by insertion of the inhibitory loop into the active site pocket and interference with the catalytic residues of the protease.


Pssm-ID: 238120  Cd Length: 60  Bit Score: 45.13  E-value: 2.44e-07
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4507065   80 NPTRRKPGKCPV---TYGQCLMLN------PPNFCEMDGQCKRDLKCCMGMCGKSCVSPV 130
Cdd:cd00199   1 GNNMTKPGSCPRpveKPGRCPMVNppslgiPPNRCSSDSDCPGDKKCCENGCGKSCLTPV 60
WAP pfam00095
WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or ...
31-73 2.37e-05

WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or elastase-specific inhibitors.


Pssm-ID: 306578  Cd Length: 44  Bit Score: 39.08  E-value: 2.37e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 4507065     31 KAGVCPPKKSAQCLRYK-KPECQSDWQCPGKKRCCPDTCGIKCL 73
Cdd:pfam00095   1 KPGVCPPPPLSCVPGGIcLDECSSDSDCPGGQKCCSNGCGRVCV 44
WAP pfam00095
WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or ...
85-127 6.72e-05

WAP-type (Whey Acidic Protein) 'four-disulfide core'; WAP belongs to the group of Elafin or elastase-specific inhibitors.


Pssm-ID: 306578  Cd Length: 44  Bit Score: 37.92  E-value: 6.72e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 4507065     85 KPGKCPVTYGQCLM-LNPPNFCEMDGQCKRDLKCCMGMCGKSCV 127
Cdd:pfam00095   1 KPGVCPPPPLSCVPgGICLDECSSDSDCPGGQKCCSNGCGRVCV 44
WAP smart00217
Four-disulfide core domains;
31-76 1.35e-04

Four-disulfide core domains;


Pssm-ID: 197580  Cd Length: 47  Bit Score: 37.35  E-value: 1.35e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 4507065      31 KAGVCPPKKSAQC-LRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPV 76
Cdd:smart00217   1 KPGSCPWPTIASCpLGNPPNKCSSDSQCPGVKKCCFNGCGKSCLTPV 47
WAP cd00199
whey acidic protein-type four-disulfide core domains. Members of the family include whey ...
31-76 1.85e-03

whey acidic protein-type four-disulfide core domains. Members of the family include whey acidic protein, elafin (elastase-specific inhibitor), caltrin-like protein (a calcium transport inhibitor) and other extracellular proteinase inhibitors. A group of proteins containing 8 characteristically-spaced cysteine residuesforming disulphide bonds, have been termed '4-disulphide core' proteins. Protease inhibition occurs by insertion of the inhibitory loop into the active site pocket and interference with the catalytic residues of the protease.


Pssm-ID: 238120  Cd Length: 60  Bit Score: 34.35  E-value: 1.85e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 4507065   31 KAGVCPpKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPV 76
Cdd:cd00199  16 KPGRCP-MVNPPSLGIPPNRCSSDSDCPGDKKCCENGCGKSCLTPV 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH