NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4501989|ref|NP_001125|]
View 

alpha-fetoprotein isoform 1 precursor [Homo sapiens]

Protein Classification

ALBUMIN domain-containing protein (domain architecture ID 11254145)

ALBUMIN domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ALBUMIN smart00103
serum albumin;
404-594 1.25e-62

serum albumin;


:

Pssm-ID: 214517  Cd Length: 187  Bit Score: 207.93  E-value: 1.25e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     404 YIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEdkLLACGEGAADIIIGH 483
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCADGD--ALECAEDELSLLLDE 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     484 LCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETyvPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQI 563
Cdd:smart00103  79 LCEDQELLSVNPKLAECCEKSGLERRPCFLALKNDEV--PPELPPDKFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPEL 156
                          170       180       190
                   ....*....|....*....|....*....|.
gi 4501989     564 TEEQLEAVIADFSGLLEKCCQGQEQEVCFAE 594
Cdd:smart00103 157 SEPQLLRVAKEYEALLEKCCAAEDPEACFAT 187
ALBUMIN smart00103
serum albumin;
212-396 1.42e-59

serum albumin;


:

Pssm-ID: 214517  Cd Length: 187  Bit Score: 199.46  E-value: 1.42e-59
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     212 ELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCR-GDVLDCLQD-GEKIMSYIC 289
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCAdGDALECAEDeLSLLLDELC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     290 SQQDTLSN--KITECCKLTTLERGQCIIHAENDEKPEGLSPNlnRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAV 367
Cdd:smart00103  81 EDQELLSVnpKLAECCEKSGLERRPCFLALKNDEVPPELPPD--KFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPELSE 158
                          170       180
                   ....*....|....*....|....*....
gi 4501989     368 SVILRVAKGYQELLEKCFQTENPLECQDK 396
Cdd:smart00103 159 PQLLRVAKEYEALLEKCCAAEDPEACFAT 187
ALBUMIN smart00103
serum albumin;
20-204 1.26e-58

serum albumin;


:

Pssm-ID: 214517  Cd Length: 187  Bit Score: 197.15  E-value: 1.26e-58
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989      20 TLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELC 99
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCADGDALECAEDELSLLLDELC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     100 HEKEILEKYGH-SDCCSQSEEGRHNCFLAHKK-PTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPT 177
Cdd:smart00103  81 EDQELLSVNPKlAECCEKSGLERRPCFLALKNdEVPPELPPDKFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPELSEPQ 160
                          170       180
                   ....*....|....*....|....*..
gi 4501989     178 ILLWAARYDKIIPSCCKAENAVECFQT 204
Cdd:smart00103 161 LLRVAKEYEALLEKCCAAEDPEACFAT 187
 
Name Accession Description Interval E-value
ALBUMIN smart00103
serum albumin;
404-594 1.25e-62

serum albumin;


Pssm-ID: 214517  Cd Length: 187  Bit Score: 207.93  E-value: 1.25e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     404 YIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEdkLLACGEGAADIIIGH 483
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCADGD--ALECAEDELSLLLDE 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     484 LCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETyvPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQI 563
Cdd:smart00103  79 LCEDQELLSVNPKLAECCEKSGLERRPCFLALKNDEV--PPELPPDKFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPEL 156
                          170       180       190
                   ....*....|....*....|....*....|.
gi 4501989     564 TEEQLEAVIADFSGLLEKCCQGQEQEVCFAE 594
Cdd:smart00103 157 SEPQLLRVAKEYEALLEKCCAAEDPEACFAT 187
Serum_albumin pfam00273
Serum albumin family;
414-592 3.71e-60

Serum albumin family;


Pssm-ID: 306728  Cd Length: 176  Bit Score: 200.94  E-value: 3.71e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    414 RSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQlsEDKLLACGEGAADIIIGHLCIRHEMTPV 493
Cdd:pfam00273   1 HVCDRFQKLGEENFKALLLIRLSQKFPQASFEELVKLVKDVTKVAEKCCA--DGDLLECAEDRLSLLLGKICSNQELSPK 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    494 NPGVGQCCTSSYANRRPCFSSLV-VDETYVPPAFSDdkFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVI 572
Cdd:pfam00273  79 SSKVADCCSKSLLERRPCFLALKnDDPTYLPPPLSP--FTEPEDLCQAYEEEKQSFLQRFLYELSRRHPELPAPQLLRVA 156
                         170       180
                  ....*....|....*....|
gi 4501989    573 ADFSGLLEKCCQGQEQEVCF 592
Cdd:pfam00273 157 KGYEELLEKCCKAEDPEACF 176
ALBUMIN smart00103
serum albumin;
212-396 1.42e-59

serum albumin;


Pssm-ID: 214517  Cd Length: 187  Bit Score: 199.46  E-value: 1.42e-59
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     212 ELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCR-GDVLDCLQD-GEKIMSYIC 289
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCAdGDALECAEDeLSLLLDELC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     290 SQQDTLSN--KITECCKLTTLERGQCIIHAENDEKPEGLSPNlnRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAV 367
Cdd:smart00103  81 EDQELLSVnpKLAECCEKSGLERRPCFLALKNDEVPPELPPD--KFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPELSE 158
                          170       180
                   ....*....|....*....|....*....
gi 4501989     368 SVILRVAKGYQELLEKCFQTENPLECQDK 396
Cdd:smart00103 159 PQLLRVAKEYEALLEKCCAAEDPEACFAT 187
ALBUMIN cd00015
Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily ...
413-599 2.63e-59

Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily includes alpha-fetoprotein which binds various cations, fatty acids and bilirubin; vitamin D-binding protein which binds to vitamin D, its metabolites, and fatty acids; alpha-albumin which binds water, cations (such as Ca2+, Na+ and K+), fatty acids, hormones, bilirubin and drugs; and afamin of which little is known; these belong to a multigene family with highly conserved intron/exon organization and encoded protein structures; evolutionary comparisons strongly support vitamin D-binding protein as the original gene in this group with subsequent local duplications generating the remaining genes in the cluster


Pssm-ID: 237982  Cd Length: 185  Bit Score: 198.70  E-value: 2.63e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  413 KRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLseDKLLACGEGAADIIIGHLCIRHEMTP 492
Cdd:cd00015   1 KQICSRLKKLGERDFKALTLVRYSQKAPQATFEELVKLVKEVTKVAKKCCAG--DKAPECAEEELSALLDELCSDEEKLS 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  493 VNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVI 572
Cdd:cd00015  79 ISPGVSHCCEKSGLERRPCFLALKKDEPPVPPSFNPFVFPEDEEVCQAFEEDPQKFLGRFLYEYSRRHPELSVPELLRLA 158
                       170       180
                ....*....|....*....|....*..
gi 4501989  573 ADFSGLLEKCCQGQEQEVCFAEEGQKL 599
Cdd:cd00015 159 KEYEELLEKCCAAEDKEACFDTKRAEL 185
Serum_albumin pfam00273
Serum albumin family;
222-393 3.77e-59

Serum albumin family;


Pssm-ID: 306728  Cd Length: 176  Bit Score: 198.25  E-value: 3.77e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    222 HACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCC-RGDVLDCLQDG-EKIMSYICSQQDTL--SN 297
Cdd:pfam00273   1 HVCDRFQKLGEENFKALLLIRLSQKFPQASFEELVKLVKDVTKVAEKCCaDGDLLECAEDRlSLLLGKICSNQELSpkSS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    298 KITECCKLTTLERGQCIIHAENDeKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGY 377
Cdd:pfam00273  81 KVADCCSKSLLERRPCFLALKND-DPTYLPPPLSPFTEPEDLCQAYEEEKQSFLQRFLYELSRRHPELPAPQLLRVAKGY 159
                         170
                  ....*....|....*.
gi 4501989    378 QELLEKCFQTENPLEC 393
Cdd:pfam00273 160 EELLEKCCKAEDPEAC 175
ALBUMIN smart00103
serum albumin;
20-204 1.26e-58

serum albumin;


Pssm-ID: 214517  Cd Length: 187  Bit Score: 197.15  E-value: 1.26e-58
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989      20 TLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELC 99
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCADGDALECAEDELSLLLDELC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     100 HEKEILEKYGH-SDCCSQSEEGRHNCFLAHKK-PTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPT 177
Cdd:smart00103  81 EDQELLSVNPKlAECCEKSGLERRPCFLALKNdEVPPELPPDKFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPELSEPQ 160
                          170       180
                   ....*....|....*....|....*..
gi 4501989     178 ILLWAARYDKIIPSCCKAENAVECFQT 204
Cdd:smart00103 161 LLRVAKEYEALLEKCCAAEDPEACFAT 187
Serum_albumin pfam00273
Serum albumin family;
30-202 2.03e-58

Serum albumin family;


Pssm-ID: 306728  Cd Length: 176  Bit Score: 195.94  E-value: 2.03e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     30 SILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYG 109
Cdd:pfam00273   1 HVCDRFQKLGEENFKALLLIRLSQKFPQASFEELVKLVKDVTKVAEKCCADGDLLECAEDRLSLLLGKICSNQELSPKSS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    110 H-SDCCSQSEEGRHNCFLAHKKPTPASIPLFQVP--EPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYD 186
Cdd:pfam00273  81 KvADCCSKSLLERRPCFLALKNDDPTYLPPPLSPftEPEDLCQAYEEEKQSFLQRFLYELSRRHPELPAPQLLRVAKGYE 160
                         170
                  ....*....|....*.
gi 4501989    187 KIIPSCCKAENAVECF 202
Cdd:pfam00273 161 ELLEKCCKAEDPEACF 176
ALBUMIN cd00015
Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily ...
221-401 8.15e-57

Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily includes alpha-fetoprotein which binds various cations, fatty acids and bilirubin; vitamin D-binding protein which binds to vitamin D, its metabolites, and fatty acids; alpha-albumin which binds water, cations (such as Ca2+, Na+ and K+), fatty acids, hormones, bilirubin and drugs; and afamin of which little is known; these belong to a multigene family with highly conserved intron/exon organization and encoded protein structures; evolutionary comparisons strongly support vitamin D-binding protein as the original gene in this group with subsequent local duplications generating the remaining genes in the cluster


Pssm-ID: 237982  Cd Length: 185  Bit Score: 192.16  E-value: 8.15e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  221 QHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGD-VLDCLQ-DGEKIMSYICSQQ--DTLS 296
Cdd:cd00015   1 KQICSRLKKLGERDFKALTLVRYSQKAPQATFEELVKLVKEVTKVAKKCCAGDkAPECAEeELSALLDELCSDEekLSIS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  297 NKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKG 376
Cdd:cd00015  81 PGVSHCCEKSGLERRPCFLALKKDEPPVPPSFNPFVFPEDEEVCQAFEEDPQKFLGRFLYEYSRRHPELSVPELLRLAKE 160
                       170       180
                ....*....|....*....|....*
gi 4501989  377 YQELLEKCFQTENPLECQDKGEEEL 401
Cdd:cd00015 161 YEELLEKCCAAEDKEACFDTKRAEL 185
ALBUMIN cd00015
Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily ...
33-208 1.61e-54

Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily includes alpha-fetoprotein which binds various cations, fatty acids and bilirubin; vitamin D-binding protein which binds to vitamin D, its metabolites, and fatty acids; alpha-albumin which binds water, cations (such as Ca2+, Na+ and K+), fatty acids, hormones, bilirubin and drugs; and afamin of which little is known; these belong to a multigene family with highly conserved intron/exon organization and encoded protein structures; evolutionary comparisons strongly support vitamin D-binding protein as the original gene in this group with subsequent local duplications generating the remaining genes in the cluster


Pssm-ID: 237982  Cd Length: 185  Bit Score: 185.99  E-value: 1.61e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989   33 DSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILE-KYGHS 111
Cdd:cd00015   5 SRLKKLGERDFKALTLVRYSQKAPQATFEELVKLVKEVTKVAKKCCAGDKAPECAEEELSALLDELCSDEEKLSiSPGVS 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  112 DCCSQSEEGRHNCFLAHKKPTPASIP---LFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKI 188
Cdd:cd00015  85 HCCEKSGLERRPCFLALKKDEPPVPPsfnPFVFPEDEEVCQAFEEDPQKFLGRFLYEYSRRHPELSVPELLRLAKEYEEL 164
                       170       180
                ....*....|....*....|
gi 4501989  189 IPSCCKAENAVECFQTKAAT 208
Cdd:cd00015 165 LEKCCAAEDKEACFDTKRAE 184
 
Name Accession Description Interval E-value
ALBUMIN smart00103
serum albumin;
404-594 1.25e-62

serum albumin;


Pssm-ID: 214517  Cd Length: 187  Bit Score: 207.93  E-value: 1.25e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     404 YIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEdkLLACGEGAADIIIGH 483
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCADGD--ALECAEDELSLLLDE 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     484 LCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETyvPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQI 563
Cdd:smart00103  79 LCEDQELLSVNPKLAECCEKSGLERRPCFLALKNDEV--PPELPPDKFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPEL 156
                          170       180       190
                   ....*....|....*....|....*....|.
gi 4501989     564 TEEQLEAVIADFSGLLEKCCQGQEQEVCFAE 594
Cdd:smart00103 157 SEPQLLRVAKEYEALLEKCCAAEDPEACFAT 187
Serum_albumin pfam00273
Serum albumin family;
414-592 3.71e-60

Serum albumin family;


Pssm-ID: 306728  Cd Length: 176  Bit Score: 200.94  E-value: 3.71e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    414 RSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQlsEDKLLACGEGAADIIIGHLCIRHEMTPV 493
Cdd:pfam00273   1 HVCDRFQKLGEENFKALLLIRLSQKFPQASFEELVKLVKDVTKVAEKCCA--DGDLLECAEDRLSLLLGKICSNQELSPK 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    494 NPGVGQCCTSSYANRRPCFSSLV-VDETYVPPAFSDdkFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVI 572
Cdd:pfam00273  79 SSKVADCCSKSLLERRPCFLALKnDDPTYLPPPLSP--FTEPEDLCQAYEEEKQSFLQRFLYELSRRHPELPAPQLLRVA 156
                         170       180
                  ....*....|....*....|
gi 4501989    573 ADFSGLLEKCCQGQEQEVCF 592
Cdd:pfam00273 157 KGYEELLEKCCKAEDPEACF 176
ALBUMIN smart00103
serum albumin;
212-396 1.42e-59

serum albumin;


Pssm-ID: 214517  Cd Length: 187  Bit Score: 199.46  E-value: 1.42e-59
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     212 ELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCR-GDVLDCLQD-GEKIMSYIC 289
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCAdGDALECAEDeLSLLLDELC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     290 SQQDTLSN--KITECCKLTTLERGQCIIHAENDEKPEGLSPNlnRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAV 367
Cdd:smart00103  81 EDQELLSVnpKLAECCEKSGLERRPCFLALKNDEVPPELPPD--KFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPELSE 158
                          170       180
                   ....*....|....*....|....*....
gi 4501989     368 SVILRVAKGYQELLEKCFQTENPLECQDK 396
Cdd:smart00103 159 PQLLRVAKEYEALLEKCCAAEDPEACFAT 187
ALBUMIN cd00015
Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily ...
413-599 2.63e-59

Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily includes alpha-fetoprotein which binds various cations, fatty acids and bilirubin; vitamin D-binding protein which binds to vitamin D, its metabolites, and fatty acids; alpha-albumin which binds water, cations (such as Ca2+, Na+ and K+), fatty acids, hormones, bilirubin and drugs; and afamin of which little is known; these belong to a multigene family with highly conserved intron/exon organization and encoded protein structures; evolutionary comparisons strongly support vitamin D-binding protein as the original gene in this group with subsequent local duplications generating the remaining genes in the cluster


Pssm-ID: 237982  Cd Length: 185  Bit Score: 198.70  E-value: 2.63e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  413 KRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLseDKLLACGEGAADIIIGHLCIRHEMTP 492
Cdd:cd00015   1 KQICSRLKKLGERDFKALTLVRYSQKAPQATFEELVKLVKEVTKVAKKCCAG--DKAPECAEEELSALLDELCSDEEKLS 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  493 VNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVI 572
Cdd:cd00015  79 ISPGVSHCCEKSGLERRPCFLALKKDEPPVPPSFNPFVFPEDEEVCQAFEEDPQKFLGRFLYEYSRRHPELSVPELLRLA 158
                       170       180
                ....*....|....*....|....*..
gi 4501989  573 ADFSGLLEKCCQGQEQEVCFAEEGQKL 599
Cdd:cd00015 159 KEYEELLEKCCAAEDKEACFDTKRAEL 185
Serum_albumin pfam00273
Serum albumin family;
222-393 3.77e-59

Serum albumin family;


Pssm-ID: 306728  Cd Length: 176  Bit Score: 198.25  E-value: 3.77e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    222 HACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCC-RGDVLDCLQDG-EKIMSYICSQQDTL--SN 297
Cdd:pfam00273   1 HVCDRFQKLGEENFKALLLIRLSQKFPQASFEELVKLVKDVTKVAEKCCaDGDLLECAEDRlSLLLGKICSNQELSpkSS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    298 KITECCKLTTLERGQCIIHAENDeKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGY 377
Cdd:pfam00273  81 KVADCCSKSLLERRPCFLALKND-DPTYLPPPLSPFTEPEDLCQAYEEEKQSFLQRFLYELSRRHPELPAPQLLRVAKGY 159
                         170
                  ....*....|....*.
gi 4501989    378 QELLEKCFQTENPLEC 393
Cdd:pfam00273 160 EELLEKCCKAEDPEAC 175
ALBUMIN smart00103
serum albumin;
20-204 1.26e-58

serum albumin;


Pssm-ID: 214517  Cd Length: 187  Bit Score: 197.15  E-value: 1.26e-58
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989      20 TLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELC 99
Cdd:smart00103   1 EVEEREALKKQVCDSLQKLGERNFKALLLIRYSQKVPQASFEEVVKLVKDVTKVAKKCCADGDALECAEDELSLLLDELC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     100 HEKEILEKYGH-SDCCSQSEEGRHNCFLAHKK-PTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPT 177
Cdd:smart00103  81 EDQELLSVNPKlAECCEKSGLERRPCFLALKNdEVPPELPPDKFPEDKDVCQAYEEDKDVFLGKFLYELSRRHPELSEPQ 160
                          170       180
                   ....*....|....*....|....*..
gi 4501989     178 ILLWAARYDKIIPSCCKAENAVECFQT 204
Cdd:smart00103 161 LLRVAKEYEALLEKCCAAEDPEACFAT 187
Serum_albumin pfam00273
Serum albumin family;
30-202 2.03e-58

Serum albumin family;


Pssm-ID: 306728  Cd Length: 176  Bit Score: 195.94  E-value: 2.03e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989     30 SILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYG 109
Cdd:pfam00273   1 HVCDRFQKLGEENFKALLLIRLSQKFPQASFEELVKLVKDVTKVAEKCCADGDLLECAEDRLSLLLGKICSNQELSPKSS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989    110 H-SDCCSQSEEGRHNCFLAHKKPTPASIPLFQVP--EPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYD 186
Cdd:pfam00273  81 KvADCCSKSLLERRPCFLALKNDDPTYLPPPLSPftEPEDLCQAYEEEKQSFLQRFLYELSRRHPELPAPQLLRVAKGYE 160
                         170
                  ....*....|....*.
gi 4501989    187 KIIPSCCKAENAVECF 202
Cdd:pfam00273 161 ELLEKCCKAEDPEACF 176
ALBUMIN cd00015
Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily ...
221-401 8.15e-57

Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily includes alpha-fetoprotein which binds various cations, fatty acids and bilirubin; vitamin D-binding protein which binds to vitamin D, its metabolites, and fatty acids; alpha-albumin which binds water, cations (such as Ca2+, Na+ and K+), fatty acids, hormones, bilirubin and drugs; and afamin of which little is known; these belong to a multigene family with highly conserved intron/exon organization and encoded protein structures; evolutionary comparisons strongly support vitamin D-binding protein as the original gene in this group with subsequent local duplications generating the remaining genes in the cluster


Pssm-ID: 237982  Cd Length: 185  Bit Score: 192.16  E-value: 8.15e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  221 QHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGD-VLDCLQ-DGEKIMSYICSQQ--DTLS 296
Cdd:cd00015   1 KQICSRLKKLGERDFKALTLVRYSQKAPQATFEELVKLVKEVTKVAKKCCAGDkAPECAEeELSALLDELCSDEekLSIS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  297 NKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKG 376
Cdd:cd00015  81 PGVSHCCEKSGLERRPCFLALKKDEPPVPPSFNPFVFPEDEEVCQAFEEDPQKFLGRFLYEYSRRHPELSVPELLRLAKE 160
                       170       180
                ....*....|....*....|....*
gi 4501989  377 YQELLEKCFQTENPLECQDKGEEEL 401
Cdd:cd00015 161 YEELLEKCCAAEDKEACFDTKRAEL 185
ALBUMIN cd00015
Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily ...
33-208 1.61e-54

Albumin domain, contains five or six internal disulphide bonds; albuminoid superfamily includes alpha-fetoprotein which binds various cations, fatty acids and bilirubin; vitamin D-binding protein which binds to vitamin D, its metabolites, and fatty acids; alpha-albumin which binds water, cations (such as Ca2+, Na+ and K+), fatty acids, hormones, bilirubin and drugs; and afamin of which little is known; these belong to a multigene family with highly conserved intron/exon organization and encoded protein structures; evolutionary comparisons strongly support vitamin D-binding protein as the original gene in this group with subsequent local duplications generating the remaining genes in the cluster


Pssm-ID: 237982  Cd Length: 185  Bit Score: 185.99  E-value: 1.61e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989   33 DSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILE-KYGHS 111
Cdd:cd00015   5 SRLKKLGERDFKALTLVRYSQKAPQATFEELVKLVKEVTKVAKKCCAGDKAPECAEEELSALLDELCSDEEKLSiSPGVS 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4501989  112 DCCSQSEEGRHNCFLAHKKPTPASIP---LFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKI 188
Cdd:cd00015  85 HCCEKSGLERRPCFLALKKDEPPVPPsfnPFVFPEDEEVCQAFEEDPQKFLGRFLYEYSRRHPELSVPELLRLAKEYEEL 164
                       170       180
                ....*....|....*....|
gi 4501989  189 IPSCCKAENAVECFQTKAAT 208
Cdd:cd00015 165 LEKCCAAEDKEACFDTKRAE 184
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH