NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|42526147|ref|NP_971245|]
View 

sigma factor regulatory protein [Treponema denticola ATCC 35405]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RsbU super family cl26706
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
403-707 3.75e-38

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


The actual alignment was detected with superfamily member COG2208:

Pssm-ID: 331527  Cd Length: 367  Bit Score: 146.39  E-value: 3.75e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 403 MYAEILICVREgqKLIGVISISSKKRKEAYTTYDFDV-LNSLYSYFFLVVYYLRniAKQdivLILDREIEMSDQIIGSIQ 481
Cdd:COG2208  67 LPVEVLLGVSG--KLRALSEEIKHWRGGLPLVAELLVeINRAVGLVSAHNELLL--LEQ---NNISAELEVARQIQQNLL 139
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 482 KNIdIVEKKVIDVDSVAFSAHQLGGDFTDFIRLSEDRYLFLIGDVSGKGLSASMSMVILKSVLHTYLSETP-DFKELVIK 560
Cdd:COG2208 140 PKA-LPLFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPlDPADVLET 218
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 561 INTFIKENLPKGTFLAGLFGIIDFKTTTIYYLNCGIPLMSMYIDSYK-NVIEIQGEGRVLGFVKNIRPFlkVRKITMNRN 639
Cdd:COG2208 219 LNRVLKQNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEiEVEDLTALGLPIGLLPDYQYE--VASLQLEPG 296
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 42526147 640 DIIVFTTDGLLDSKNLKGDKFGNDRVSRLIAVNRTKSAKEISNAIYKTFLDYIA-HEIEDDITIMTFKH 707
Cdd:COG2208 297 DLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGdQIQDDDITLLVLKV 365
 
Name Accession Description Interval E-value
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
403-707 3.75e-38

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 146.39  E-value: 3.75e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 403 MYAEILICVREgqKLIGVISISSKKRKEAYTTYDFDV-LNSLYSYFFLVVYYLRniAKQdivLILDREIEMSDQIIGSIQ 481
Cdd:COG2208  67 LPVEVLLGVSG--KLRALSEEIKHWRGGLPLVAELLVeINRAVGLVSAHNELLL--LEQ---NNISAELEVARQIQQNLL 139
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 482 KNIdIVEKKVIDVDSVAFSAHQLGGDFTDFIRLSEDRYLFLIGDVSGKGLSASMSMVILKSVLHTYLSETP-DFKELVIK 560
Cdd:COG2208 140 PKA-LPLFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPlDPADVLET 218
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 561 INTFIKENLPKGTFLAGLFGIIDFKTTTIYYLNCGIPLMSMYIDSYK-NVIEIQGEGRVLGFVKNIRPFlkVRKITMNRN 639
Cdd:COG2208 219 LNRVLKQNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEiEVEDLTALGLPIGLLPDYQYE--VASLQLEPG 296
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 42526147 640 DIIVFTTDGLLDSKNLKGDKFGNDRVSRLIAVNRTKSAKEISNAIYKTFLDYIA-HEIEDDITIMTFKH 707
Cdd:COG2208 297 DLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGdQIQDDDITLLVLKV 365
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
516-707 4.67e-38

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 141.24  E-value: 4.67e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147   516 EDRYLFLIGDVSGKGLSASMSMVILKSVLHTYLSETPDFKELVIKINTFIKENLPKGTFLAGLFGIIDFKTTTIYYLNCG 595
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147   596 IPLMSMYIDSYKNVIEIQGEGRVLGFVKNirPFLKVRKITMNRNDIIVFTTDGLLDSKNLKGDKFGNDRVSRLIAVNRTK 675
Cdd:pfam07228  81 HPPPLLLRPDGGVVELLESTGLPLGILPD--ADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGL 158
                         170       180       190
                  ....*....|....*....|....*....|..
gi 42526147   676 SAKEISNAIYKTFLDYIAHEIEDDITIMTFKH 707
Cdd:pfam07228 159 PPEELLDALLEALLRLGGGELEDDITLLVLRV 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
491-685 2.74e-36

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 136.32  E-value: 2.74e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147    491 VIDVDSVAFSAHQLGGDFTDFIRLSEDRYLFLIGDVSGKGLSASMSMVILKSVLHTYLSETPDFKELVIKINTFIKENLP 570
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147    571 KGTFLAGLFGIIDFKTTTIYYLNCGIPLMSMYIDSYKNVIEIQGEGRVLGFVKNirPFLKVRKITMNRNDIIVFTTDGLL 650
Cdd:smart00331  83 DGMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPD--VEVDVRELTLEPGDLLLLYTDGLT 160
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 42526147    651 DSKNLkgdkfgnDRVSRLIAVNRTKSAKEISNAIY 685
Cdd:smart00331 161 EARNP-------ERLEELLEELLGSPPAEIAQRIL 188
 
Name Accession Description Interval E-value
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
403-707 3.75e-38

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 146.39  E-value: 3.75e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 403 MYAEILICVREgqKLIGVISISSKKRKEAYTTYDFDV-LNSLYSYFFLVVYYLRniAKQdivLILDREIEMSDQIIGSIQ 481
Cdd:COG2208  67 LPVEVLLGVSG--KLRALSEEIKHWRGGLPLVAELLVeINRAVGLVSAHNELLL--LEQ---NNISAELEVARQIQQNLL 139
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 482 KNIdIVEKKVIDVDSVAFSAHQLGGDFTDFIRLSEDRYLFLIGDVSGKGLSASMSMVILKSVLHTYLSETP-DFKELVIK 560
Cdd:COG2208 140 PKA-LPLFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPlDPADVLET 218
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147 561 INTFIKENLPKGTFLAGLFGIIDFKTTTIYYLNCGIPLMSMYIDSYK-NVIEIQGEGRVLGFVKNIRPFlkVRKITMNRN 639
Cdd:COG2208 219 LNRVLKQNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEiEVEDLTALGLPIGLLPDYQYE--VASLQLEPG 296
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 42526147 640 DIIVFTTDGLLDSKNLKGDKFGNDRVSRLIAVNRTKSAKEISNAIYKTFLDYIA-HEIEDDITIMTFKH 707
Cdd:COG2208 297 DLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGdQIQDDDITLLVLKV 365
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
516-707 4.67e-38

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 141.24  E-value: 4.67e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147   516 EDRYLFLIGDVSGKGLSASMSMVILKSVLHTYLSETPDFKELVIKINTFIKENLPKGTFLAGLFGIIDFKTTTIYYLNCG 595
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147   596 IPLMSMYIDSYKNVIEIQGEGRVLGFVKNirPFLKVRKITMNRNDIIVFTTDGLLDSKNLKGDKFGNDRVSRLIAVNRTK 675
Cdd:pfam07228  81 HPPPLLLRPDGGVVELLESTGLPLGILPD--ADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGL 158
                         170       180       190
                  ....*....|....*....|....*....|..
gi 42526147   676 SAKEISNAIYKTFLDYIAHEIEDDITIMTFKH 707
Cdd:pfam07228 159 PPEELLDALLEALLRLGGGELEDDITLLVLRV 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
491-685 2.74e-36

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 136.32  E-value: 2.74e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147    491 VIDVDSVAFSAHQLGGDFTDFIRLSEDRYLFLIGDVSGKGLSASMSMVILKSVLHTYLSETPDFKELVIKINTFIKENLP 570
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526147    571 KGTFLAGLFGIIDFKTTTIYYLNCGIPLMSMYIDSYKNVIEIQGEGRVLGFVKNirPFLKVRKITMNRNDIIVFTTDGLL 650
Cdd:smart00331  83 DGMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPD--VEVDVRELTLEPGDLLLLYTDGLT 160
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 42526147    651 DSKNLkgdkfgnDRVSRLIAVNRTKSAKEISNAIY 685
Cdd:smart00331 161 EARNP-------ERLEELLEELLGSPPAEIAQRIL 188
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH