NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|42476193|ref|NP_057211|]
View 

store-operated calcium entry-associated regulatory factor isoform 1 precursor [Homo sapiens]

Protein Classification

SARAF domain-containing protein (domain architecture ID 12071519)

SARAF domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SARAF pfam06682
SOCE-associated regulatory factor of calcium homoeostasis; SARAF is as family of eukaryotic ...
24-339 2.21e-105

SOCE-associated regulatory factor of calcium homoeostasis; SARAF is as family of eukaryotic proteins embedded in the ER. SARAF is SOCE-associated regulatory factor, where SOCE is store operated calcium entry. ie a mechanism governing calcium homoeostasis in the cell and the mitochondria. SOCE involves the enabling of Ca2+ release-activated Ca2+ (CRAC) channels. SARAF is a single pass ER membrane protein whose systolic-facing domain is responsible for activity and whose luminary-facing domain carries out a regulatory function in conjunction with another membrane protein STIM, an ER single pass membrane protein that detects changes in ER Ca2+ levels through its EF-hand, conserved Ca2+ binding domain. STIM is the major target for SARAF regulation, and thus SARAF negatively regulates the SOCE entry of calcium into cells protecting them from overfilling.


:

Pssm-ID: 310939  Cd Length: 298  Bit Score: 314.58  E-value: 2.21e-105
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193    24 TAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDS--YTPKVIQCQNKGWDGYDVQWECKTDL 101
Cdd:pfam06682   6 VVGPALAWASPDKVLLSDVQSLTLRRGRYTTSRRVSPIPQLKCVGGSAGCLCglYEPDVMQCTNQGSDGEDVQWECKADL 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   102 DIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSadscNMSGLITIVV 181
Cdd:pfam06682  86 PEEFKLGSTDVSCEGYDSPDDPYVLKGSCGVEYRLELTEEGERKYGKSGGSGGGSSGYVSGSGSSS----SAGGLFWVAV 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   182 LLGIAFVVYKLFLSDGQYSPPPYSEYPPFSH---------RYQRFTNSAGPPPPGFKSEFTGPQNTGHGatsgfgsaftg 252
Cdd:pfam06682 162 LGVIAWIVYSAFLSGGQNRRGGPGGGRRGGGgggggggggGGGDFGPGNGPPPPYFKSYGTQQSSSQNG----------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   253 qqgyenSGPGFWTGLGTGGILGYLFGSNRA---ATPFSDSWyypsyppsypgtwnraYSPLHGGSGSYSVCSNSDTKTRT 329
Cdd:pfam06682 231 ------WRPGFWTGAATGGAAGYLAGRRRNrnnATNRSSRW----------------GGGSYPGSSSYSSSSSSSSSTRT 288
                         330
                  ....*....|
gi 42476193   330 ASGYGGTRRR 339
Cdd:pfam06682 289 STGFGGTRRR 298
 
Name Accession Description Interval E-value
SARAF pfam06682
SOCE-associated regulatory factor of calcium homoeostasis; SARAF is as family of eukaryotic ...
24-339 2.21e-105

SOCE-associated regulatory factor of calcium homoeostasis; SARAF is as family of eukaryotic proteins embedded in the ER. SARAF is SOCE-associated regulatory factor, where SOCE is store operated calcium entry. ie a mechanism governing calcium homoeostasis in the cell and the mitochondria. SOCE involves the enabling of Ca2+ release-activated Ca2+ (CRAC) channels. SARAF is a single pass ER membrane protein whose systolic-facing domain is responsible for activity and whose luminary-facing domain carries out a regulatory function in conjunction with another membrane protein STIM, an ER single pass membrane protein that detects changes in ER Ca2+ levels through its EF-hand, conserved Ca2+ binding domain. STIM is the major target for SARAF regulation, and thus SARAF negatively regulates the SOCE entry of calcium into cells protecting them from overfilling.


Pssm-ID: 310939  Cd Length: 298  Bit Score: 314.58  E-value: 2.21e-105
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193    24 TAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDS--YTPKVIQCQNKGWDGYDVQWECKTDL 101
Cdd:pfam06682   6 VVGPALAWASPDKVLLSDVQSLTLRRGRYTTSRRVSPIPQLKCVGGSAGCLCglYEPDVMQCTNQGSDGEDVQWECKADL 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   102 DIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSadscNMSGLITIVV 181
Cdd:pfam06682  86 PEEFKLGSTDVSCEGYDSPDDPYVLKGSCGVEYRLELTEEGERKYGKSGGSGGGSSGYVSGSGSSS----SAGGLFWVAV 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   182 LLGIAFVVYKLFLSDGQYSPPPYSEYPPFSH---------RYQRFTNSAGPPPPGFKSEFTGPQNTGHGatsgfgsaftg 252
Cdd:pfam06682 162 LGVIAWIVYSAFLSGGQNRRGGPGGGRRGGGgggggggggGGGDFGPGNGPPPPYFKSYGTQQSSSQNG----------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   253 qqgyenSGPGFWTGLGTGGILGYLFGSNRA---ATPFSDSWyypsyppsypgtwnraYSPLHGGSGSYSVCSNSDTKTRT 329
Cdd:pfam06682 231 ------WRPGFWTGAATGGAAGYLAGRRRNrnnATNRSSRW----------------GGGSYPGSSSYSSSSSSSSSTRT 288
                         330
                  ....*....|
gi 42476193   330 ASGYGGTRRR 339
Cdd:pfam06682 289 STGFGGTRRR 298
 
Name Accession Description Interval E-value
SARAF pfam06682
SOCE-associated regulatory factor of calcium homoeostasis; SARAF is as family of eukaryotic ...
24-339 2.21e-105

SOCE-associated regulatory factor of calcium homoeostasis; SARAF is as family of eukaryotic proteins embedded in the ER. SARAF is SOCE-associated regulatory factor, where SOCE is store operated calcium entry. ie a mechanism governing calcium homoeostasis in the cell and the mitochondria. SOCE involves the enabling of Ca2+ release-activated Ca2+ (CRAC) channels. SARAF is a single pass ER membrane protein whose systolic-facing domain is responsible for activity and whose luminary-facing domain carries out a regulatory function in conjunction with another membrane protein STIM, an ER single pass membrane protein that detects changes in ER Ca2+ levels through its EF-hand, conserved Ca2+ binding domain. STIM is the major target for SARAF regulation, and thus SARAF negatively regulates the SOCE entry of calcium into cells protecting them from overfilling.


Pssm-ID: 310939  Cd Length: 298  Bit Score: 314.58  E-value: 2.21e-105
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193    24 TAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDS--YTPKVIQCQNKGWDGYDVQWECKTDL 101
Cdd:pfam06682   6 VVGPALAWASPDKVLLSDVQSLTLRRGRYTTSRRVSPIPQLKCVGGSAGCLCglYEPDVMQCTNQGSDGEDVQWECKADL 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   102 DIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSadscNMSGLITIVV 181
Cdd:pfam06682  86 PEEFKLGSTDVSCEGYDSPDDPYVLKGSCGVEYRLELTEEGERKYGKSGGSGGGSSGYVSGSGSSS----SAGGLFWVAV 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   182 LLGIAFVVYKLFLSDGQYSPPPYSEYPPFSH---------RYQRFTNSAGPPPPGFKSEFTGPQNTGHGatsgfgsaftg 252
Cdd:pfam06682 162 LGVIAWIVYSAFLSGGQNRRGGPGGGRRGGGgggggggggGGGDFGPGNGPPPPYFKSYGTQQSSSQNG----------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42476193   253 qqgyenSGPGFWTGLGTGGILGYLFGSNRA---ATPFSDSWyypsyppsypgtwnraYSPLHGGSGSYSVCSNSDTKTRT 329
Cdd:pfam06682 231 ------WRPGFWTGAATGGAAGYLAGRRRNrnnATNRSSRW----------------GGGSYPGSSSYSSSSSSSSSTRT 288
                         330
                  ....*....|
gi 42476193   330 ASGYGGTRRR 339
Cdd:pfam06682 289 STGFGGTRRR 298
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH