NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|41054914|ref|NP_955783|]
View 

C-C chemokine receptor type 7 precursor [Rattus norvegicus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
59-337 4.64e-136

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15175:

Pssm-ID: 333717  Cd Length: 278  Bit Score: 393.75  E-value: 4.64e-136
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15175   1 WFLPAMYSVICFLGLLGNGLVILTYIYFKRLKTMTDIYLLNLALADILFLLTLPFWAASAAKKWVFGEEMCKAVYCLYKM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNsgEDTWRCSL-VSAQV 217
Cdd:cd15175  81 SFFSGMLLLMCISIDRYFAIVQAASAHRHRSRAVFISKVSSLGVWVLAFILSIPELLYSGVNNN--DGNGTCSIfTNNKQ 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSS 297
Cdd:cd15175 159 TLSVKIQISQMVLGFLVPLVVMSFCYSVIIKTLLQARNFEKNKAIKVIIAVVVVFVVFQLPYNSVMLVSTLSSFKNNTTD 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 41054914 298 CEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15175 239 CDYSKNLDFALDVTYSLACFRCCLNPFLYAFIGVKFRNDL 278
 
Name Accession Description Interval E-value
7tmA_CCR7 cd15175
CC chemokine receptor type 7, member of the class A family of seven-transmembrane G ...
59-337 4.64e-136

CC chemokine receptor type 7, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR7 is a major homeostatic receptor responsible for lymph node development and effective adaptive immune responses and plays a critical role in trafficking of dendritic cells and B and T lymphocytes. Its only two ligands, CCL and CCl21, are primarily produced by stromal cells in the T cell zones of lymph nodes and spleen. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320303  Cd Length: 278  Bit Score: 393.75  E-value: 4.64e-136
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15175   1 WFLPAMYSVICFLGLLGNGLVILTYIYFKRLKTMTDIYLLNLALADILFLLTLPFWAASAAKKWVFGEEMCKAVYCLYKM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNsgEDTWRCSL-VSAQV 217
Cdd:cd15175  81 SFFSGMLLLMCISIDRYFAIVQAASAHRHRSRAVFISKVSSLGVWVLAFILSIPELLYSGVNNN--DGNGTCSIfTNNKQ 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSS 297
Cdd:cd15175 159 TLSVKIQISQMVLGFLVPLVVMSFCYSVIIKTLLQARNFEKNKAIKVIIAVVVVFVVFQLPYNSVMLVSTLSSFKNNTTD 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 41054914 298 CEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15175 239 CDYSKNLDFALDVTYSLACFRCCLNPFLYAFIGVKFRNDL 278
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
75-326 8.17e-48

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 165.56  E-value: 8.17e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914    75 GNGLVVLTYIYFKRLKTMTDTYLLNLAVADILF-LMILPFWAYSEAK-SWIFGAYLCKSIFGIYKLSFFSGMLLLLCISI 152
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFlLLTLPFWLVYALFgTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   153 DRYVAIVQAVSAHRHRARVLLIsklsCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEALIAIQVAQMVVGF 232
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRRAKAI----ILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   233 VLPMLAMSFCYLVIIRTLLQ------ARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSCEasKQLNI 306
Cdd:pfam00001 157 LLPLLVILVCYTRIIRTLRKqarsrrRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVV--TPPRT 234
                         250       260
                  ....*....|....*....|
gi 41054914   307 AYDVTYSLASVRCCVNPFLY 326
Cdd:pfam00001 235 LLQLTVWLAYSNSCLNPIIY 254
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
38-344 6.85e-39

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021  Cd Length: 417  Bit Score: 145.16  E-value: 6.85e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   38 TVDYTLYESVCFKK-DVRNFKAW-----FLPLMYSVICFVGLLGNGLVVlTYIYFKRLKTMTDTYLLNLAVADILFLMIL 111
Cdd:PHA02638  72 TYDYEYENNITYELiNIKNKCMYpsiseYIKIFYIIIFILGLFGNAAII-MILFCKKIKTITDIYIFNLAISDLIFVIDF 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  112 PFWAYSEAKSWIFGAYLCKSIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHraRVLLISKLSCIGIWTLAFFLSI 191
Cdd:PHA02638 151 PFIIYNEFDQWIFGDFMCKVISASYYIGFFSNMFLITLMSIDRYFAILYPISFQKY--RTFNIGIILCIISWILSLIITS 228
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  192 P--------ELLYSGLQKNSGEDTWRCSLVSAQVEALIA-----IQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFER 258
Cdd:PHA02638 229 PayfifeasNIIFSAQDSNETISNYQCTLIEDNEKNNISflgriLQFEINILGMFIPIIIFAFCYIKIILKLKQLKKSKK 308
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  259 NKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFN-----ITNSSCEASKqLNIAYDVTYSLASVRCCVNPFLYAFIGVKF 333
Cdd:PHA02638 309 TKSIIIVSIIIICSLICWIPLNIVILFATMYSFKgfnsiISEHICGFIK-LGYAMMLAEAISLTHCCINPLIYTLIGENF 387
                        330
                 ....*....|.
gi 41054914  334 RSDLFKLFKDL 344
Cdd:PHA02638 388 RMHLLMIFRNI 398
 
Name Accession Description Interval E-value
7tmA_CCR7 cd15175
CC chemokine receptor type 7, member of the class A family of seven-transmembrane G ...
59-337 4.64e-136

CC chemokine receptor type 7, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR7 is a major homeostatic receptor responsible for lymph node development and effective adaptive immune responses and plays a critical role in trafficking of dendritic cells and B and T lymphocytes. Its only two ligands, CCL and CCl21, are primarily produced by stromal cells in the T cell zones of lymph nodes and spleen. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320303  Cd Length: 278  Bit Score: 393.75  E-value: 4.64e-136
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15175   1 WFLPAMYSVICFLGLLGNGLVILTYIYFKRLKTMTDIYLLNLALADILFLLTLPFWAASAAKKWVFGEEMCKAVYCLYKM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNsgEDTWRCSL-VSAQV 217
Cdd:cd15175  81 SFFSGMLLLMCISIDRYFAIVQAASAHRHRSRAVFISKVSSLGVWVLAFILSIPELLYSGVNNN--DGNGTCSIfTNNKQ 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSS 297
Cdd:cd15175 159 TLSVKIQISQMVLGFLVPLVVMSFCYSVIIKTLLQARNFEKNKAIKVIIAVVVVFVVFQLPYNSVMLVSTLSSFKNNTTD 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 41054914 298 CEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15175 239 CDYSKNLDFALDVTYSLACFRCCLNPFLYAFIGVKFRNDL 278
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
59-337 6.26e-108

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320115  Cd Length: 278  Bit Score: 321.86  E-value: 6.26e-108
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd14984   1 VFLPVLYSLVFVLGLVGNSLVLLVLLYYKKLRSMTDVYLLNLALSDLLFVLTLPFWAVYAAHGWVFGSFLCKLVSALYTI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAhrHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEdtWRCSLVSAQVE 218
Cdd:cd14984  81 NFYSGILFLACISIDRYLAIVHAVSA--LRARTLLHGKLTCLAVWALALLLSLPEFIFSQVYEENGS--SRCSYIYPEDT 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 AL---IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITN 295
Cdd:cd14984 157 ATtwkTLLRLLQNILGFLLPLLVMLFCYSRIIRTLLRARNHKKHRALRLIFAVVVVFFLCWLPYNIVLLLDTLQRLGVII 236
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 41054914 296 SSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd14984 237 RSCELSKRLDYALQVTETLAFSHCCLNPVLYAFVGEKFRKYL 278
7tmA_CCR9 cd15174
CC chemokine receptor type 9, member of the class A family of seven-transmembrane G ...
60-337 4.16e-88

CC chemokine receptor type 9, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR9 is a homeostatic receptor specific for CCL25 (formerly known as thymus expressed chemokine) and is highly expressed on both immature and mature thymocytes as well as on intestinal homing T Lymphocytes and mucosal Lymphocytes. In cutaneous melanoma, activation of CCR9-CCL25 has been shown to stimulate metastasis to the small intestine. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320302  Cd Length: 280  Bit Score: 271.24  E-value: 4.16e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15174   2 FLPPLYWLIFLVGAVGNSLVVLIYTYYRRRKTMTDVYLLNLAIADLLFLCTLPFWATAASSGWVFGTFLCKVVNSMYKIN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTwrCSLVSAQVEA 219
Cdd:cd15174  82 FYSCMLLLTCISVDRYIAIVQATKAHNSKNKRLLYSKLVCFFVWLLSTILSLPEILFSQSKEEESVTT--CTMVYPSNES 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 L---IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNS 296
Cdd:cd15174 160 NrfkVAVLALKVTVGFFLPFVVMVICYTLIIHTLLQAKRFQKHKALKVIIAVVTVFVLSQLPYNSILLIKTINAYNITIT 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 41054914 297 SCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15174 240 DCATSQNLDIAGQVTQSIAFLHSCLNPFLYVFVGVRFRKDL 280
7tmA_CCR6 cd15172
CC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
60-335 4.72e-82

CC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR6 is the only known receptor identified for the chemokine CCL20 (also known as macrophage inflammatory protein-3alpha, MIP-3alpha). CCR6 is expressed by all mature human B cells, effector memory T-cells, and dendritic cells found in the gut mucosal immune system. CCL20 contributes to recruitment of CCR6-expressing cells to Peyer's patches and isolated lymphoid follicles in the intestine, thereby promoting the assembly and maintenance of organized lymphoid structures. Also, CCL20 expression is highly inducible in response to inflammatory signals. Thus, CCL20 is involved in both inflammatory and homeostatic functions in the immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320300  Cd Length: 281  Bit Score: 255.45  E-value: 4.72e-82
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15172   2 FVPVIYSLICVVGLIGNSLVVITYAFYKRTKSMTDVYLLNMAIADILFVLTLPFWAVYEAHQWIFGNFSCKLLRGIYAIN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEA 219
Cdd:cd15172  82 FYSGMLLLACISVDRYIAIVQATKSFRLRSRTLAYSKLICAAVWLLAILISLPTFIFSEVYDFMTNEQYVCEPKYPKNST 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 LIAIQVA----QMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNgVVLAQTVANFNiTN 295
Cdd:cd15172 162 AIMWKLLvlslQVSLGFFIPLLVMIFCYSFIIKTLLQAQNSQRHKAVRVVVAVVLVFLVCQVPYN-IVLLIEAINLG-EN 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 41054914 296 SSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRS 335
Cdd:cd15172 240 QSCSSEKAVAYAKTITECLAFFHCCLNPVLYAFIGVKFRN 279
7tmA_CCR10 cd15177
CC chemokine receptor type 10, member of the class A family of seven-transmembrane G ...
60-337 4.69e-81

CC chemokine receptor type 10, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR10 is a homeostatic receptor specific for two C-C motif chemokines, CCL27 and CCL28. Activation of CCR10 by its two ligands mediates diverse activities, ranging from leukocyte trafficking to skin cancer. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320305  Cd Length: 280  Bit Score: 252.76  E-value: 4.69e-81
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLK-TMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15177   2 FQPCVFLVVFVLGVVGNGLVLATFTAYRRLRlSMTDVFLLHLALADLLLLLTLPFQAADTLQGWIFGNAMCKLIQGLYAI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEdtWRCSLV---SA 215
Cdd:cd15177  82 NFYSGLLFLACISVDRYLVIVRATVAHRLRPKTLRYSVLTALIVWLVSILLSLPQLLFSRVENRSEL--SSCRMIfpeSL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 216 QVEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNiTN 295
Cdd:cd15177 160 TQTAKKATALAQVVLGFCIPFLVMAVCYALIGRTLLAARGWERHRALKVMLALVVLFVLFQLPYSVVLLLDTADLLA-TR 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 41054914 296 SSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15177 239 RSCSQSKRKDLAELVTSGLAYVRCCLNPLLYAFVGVRFRRDI 280
7tmA_CXCR6 cd15173
CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
59-334 2.20e-74

CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR6 binds specifically to the chemokine CXCL16, which is expressed on dendritic cells, monocyte/macrophages, activated T cells, fibroblastic reticular cells, and cancer cells. CXCR6 is phylogenetically more closely related to CC-type chemokine receptors (CCR6 and CCR9) than other CXC receptors. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320301  Cd Length: 270  Bit Score: 235.44  E-value: 2.20e-74
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15173   1 YFLPCMYSVMFVTGLVGNSLVIVIYIFYEKLRTLTDIFLVNLAVADLLFLCTLPFWAYSAAHEWIFGTVMCKITNGLYTI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSglqKNSGEDTWRCSLVSAQVE 218
Cdd:cd15173  81 NLYSSMLILTCITVDRFIVIVQATKAHNCHAKKMRWGKVVCTLVWVISLLLSLPQFIYS---EVRNLSSKICSMVYPPDA 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 ALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSc 298
Cdd:cd15173 158 IEVVVNIIQMTVGFFLPLLAMIICYSVIIKTLLHAKGFQKHKSLKIIFVVVAVFILTQLPYNIMKLIRTLHIENTDSTN- 236
                       250       260       270
                ....*....|....*....|....*....|....*.
gi 41054914 299 easkqLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15173 237 -----FKYAILITEAIAYLHACLNPILYAFVGVKFR 267
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
60-337 8.01e-71

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320306  Cd Length: 279  Bit Score: 226.39  E-value: 8.01e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15178   2 ALCVIYVLVFLLSLPGNSLVVLVILYNRRSRSSTDVYLLHLAIADLLFALTLPFWAVSVVKGWIFGTFMCKLVSLLQEAN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRArvlLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEA 219
Cdd:cd15178  82 FYSGILLLACISVDRYLAIVHATRALTQKR---HLVKFVCAGVWLLSLLLSLPALLNRDAFKPPNSGRTVCYENLGNESA 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 ---LIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNS 296
Cdd:cd15178 159 dkwRVVLRILRHTLGFLLPLVVMLFCYGFTIKTLLQTRSFQKHRAMRVIFAVVLAFLLCWLPYNVTVLIDTLMRTKLITE 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 41054914 297 SCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15178 239 TCELRNHVDVALYVTQILGFLHSCINPVLYAFIGQKFRNNL 279
7tmA_ACKR4_CCR11 cd15176
atypical chemokine receptor 4, member of the class A family of seven-transmembrane G ...
60-335 6.89e-67

atypical chemokine receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR4 was first reported to bind several CC chemokines including CCL19, CCL21, and CCL25 and was originally designated CCR11. AKCR4 is unable to couple to G-protein and, instead, it preferentially mediates beta-arrestin dependent processes, such as receptor internalization, after ligand binding. Thus, ACKR4 may act as a scavenger receptor to suppress the effects of proinflammatory chemokines. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320304  Cd Length: 276  Bit Score: 216.15  E-value: 6.89e-67
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15176   2 FLPVFYTIALVVGLAGNSLVVAIYAYYKKLKTKTDVYILNLAVADLLLLFTLPFWAADAVNGWVLGTAMCKITSALYTMN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSahrhRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEA 219
Cdd:cd15176  82 FSCGMQFLACISVDRYVAITKATS----RQFTGKHCWIVCLCVWLLAILLSIPDLVFSTVRENSDRYRCLPVFPPSLVTS 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 LIA-IQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSC 298
Cdd:cd15176 158 AKAtIQILEVLLGFVLPFLVMVFCYSRVARALSRTPNVKKSRALKVLLAVVGVFIVTQLPYNVVKFYRAIDVIYLLITDC 237
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 41054914 299 EASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRS 335
Cdd:cd15176 238 SMSKTLDIAIQVTESIALFHSCLNPVLYVFMGASFKS 274
7tmA_CXCR5 cd15181
CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G ...
60-337 1.24e-64

CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR5 is a B-cell selective receptor that binds specifically to the homeostatic chemokine CXCL13 and regulates adaptive immunity. The receptor is found on all peripheral blood and tonsillar B cells and is involved in lymphocyte migration (homing) to specific tissues and development of normal lymphoid tissue. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320309  Cd Length: 281  Bit Score: 210.38  E-value: 1.24e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15181   2 FIPLAYSLVFLLGVVGNGLVLTILLRRRRSRRTTENYLLHLALADLLLLLTFPFSVVESIAGWVFGTFLCKLVGAIHKLN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRArvLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEA 219
Cdd:cd15181  82 FYCSSLLLACISVDRYLAIVHAIHSYRHRR--LRSVHLTCGSIWLVCFLLSLPNLVFLEVETSTNANRTSCSFHQYGIHE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 LIAIQVAQM---VVGFVLPMLAMSFCYLVIIRTLLQA-RNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITN 295
Cdd:cd15181 160 SNWWLTSRFlyhVVGFFLPLLIMGYCYATIVVTLCQSsRRLQKQKAIRVAILVTLVFCLCWLPYNIVIFLDTLDDLKAVV 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 41054914 296 SSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15181 240 KNCKLNDLLDAAITVTESLGFSHCCLNPILYAFIGVKFRNDL 281
7tmA_CXCR4 cd15179
CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G ...
60-337 1.95e-63

CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR4 is the only known G protein-coupled chemokine receptor for the key homeostatic ligand CXCL12, which is constitutively secreted by bone marrow stromal cells. Atypical chemokine receptor CXCR7 (ACKR3) also binds CXCL12, but activates signaling in a G protein-independent manner. CXCR4 is also a co-receptor for HIV infection and plays critical roles in the development of immune system during both lymphopoiesis and myelopoiesis. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320307  Cd Length: 278  Bit Score: 207.31  E-value: 1.95e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15179   2 FLPTVYSIIFLLGIVGNGLVILVMGYQKKSRTMTDKYRLHLSVADLLFVLTLPFWAVDAAANWYFGNFLCKAVHVIYTVN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRArvLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTW-RCSLVSAQVE 218
Cdd:cd15179  82 LYSSVLILAFISLDRYLAIVHATNSQRPRK--LLAEKVVYVGVWLPALLLTVPDLVFAKVSELDGRYICdRIYPEDTFEL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 ALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSC 298
Cdd:cd15179 160 WLVAFRFQHILVGLVLPGLVILTCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGILIDTFMLLEVIKHSC 239
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 41054914 299 EASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15179 240 EMEQTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSA 278
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
60-334 6.98e-60

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320308  Cd Length: 280  Bit Score: 197.99  E-value: 6.98e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15180   2 FLPVLYSLVFLLGLLGNGLVLAVLLQKRRNLSVTDTFILHLALADILLLVTLPFWAVQAVHGWIFGTGLCKLAGAVFKIN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLisKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRC--SLVSAQV 217
Cdd:cd15180  82 FYCGIFLLACISFDRYLSIVHAVQMYSRKKPMLV--HLSCLIVWLFCLLLSIPDFIFLEATKDPRQNKTECvhNFPQSTT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQ-ARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNS 296
Cdd:cd15180 160 DWWLALRLLYHIVGFLLPLAVMVYCYTSILLRLLRsSQGFQKQRAIRVIVAVVVVFFLCWTPYNIALLVDTLIDLSVLDR 239
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 41054914 297 SCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15180 240 NCGTESRLDIALSVTSSLGYFHCCLNPLLYAFVGVKFR 277
7tmA_CCR5_CCR2 cd15184
CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G ...
60-337 4.36e-59

CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR2 and CCR5 share very high amino acid sequence identity. Both receptors play important roles in the trafficking of monocytes/macrophages and are implicated in the pathogenesis of immunologic diseases (rheumatoid arthritis, celiac disease, and transplant rejection) and cardiovascular diseases (atherosclerosis and autoimmune hepatitis). CCR2 is a receptor specific for members of the monocyte chemotactic protein family, including CCL2, CCL7, and CCL13. Conversely, CCR5 is a major co-receptor for HIV infection and binds many CC chemokine ligands, including CC chemokine ligands including CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL14, and CCL16. CCR2 is expressed primarily on blood monocytes and memory T cells, whereas CCR5 is expressed on antigen-presenting cells (macrophages and dendritic cells) and activated T effector cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320312  Cd Length: 278  Bit Score: 195.75  E-value: 4.36e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15184   2 LLPPLYSLVFIFGFVGNMLVVLILINCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAAHEWIFGNAMCKLLTGLYHIG 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAhrHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEA 219
Cdd:cd15184  82 FFSGIFFIILLTIDRYLAIVHAVFA--LKARTVTFGVVTSVVTWVVAVFASLPGIIFTRSQKEGSHYTCSPHFPPSQYQF 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 LIAIQVAQMVV-GFVLPMLAMSFCYLVIIRTLLQARNFE-RNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNsS 297
Cdd:cd15184 160 WKNFQTLKMNIlGLVLPLLVMIICYSGILKTLLRCRNEKkRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLN-N 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 41054914 298 CEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15184 239 CSSSNRLDQAMQVTETLGMTHCCINPVIYAFVGEKFRSYL 278
7tmA_CCR3 cd15185
CC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
59-337 1.19e-49

CC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR3 is a highly promiscuous receptor that binds a variety of inflammatory CC-type chemokines, including CCL11 (eotaxin-1), CCL3L1, CCL5 (regulated on activation, normal T cell expressed and secreted; RANTES), CCL7 (monocyte-specific chemokine 3 or MCP-3), CCL8 (MCP-2), CCL11, CCL13 (MCP-4), CCL15, CCL24 (eotaxin-2), CCL26 (eotaxin-3), and CCL28. Among these, the eosinophil chemotactic chemokines (CCL11, CCL24, and CCL26) are the most potent and specific ligands. In addition to eosinophil, CCR3 is expressed on cells involved in allergic responses, such as basophils, Th2 lymphocytes, and mast cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320313  Cd Length: 278  Bit Score: 171.17  E-value: 1.19e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWA-YSEAKSWIFGAYLCKSIFGIYK 137
Cdd:cd15185   1 QFLPPLYSLVFIVGLLGNVVVVVILIKYRKLRIMTNIYLLNLAISDLLFLFTLPFWIhYVRWNNWVFGHGMCKLLSGFYY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVSAhrHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQV 217
Cdd:cd15185  81 LGLYSEIFFIILLTIDRYLAIVHAVFA--LRARTVTFGIITSIITWGLAVLAALPEFIFYETQELFEEFLCSPLYPEDTE 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQM-VVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNgVVLAQTVANFNITNS 296
Cdd:cd15185 159 DSWKRFHALRMnIFGLALPLLIMVICYTGIIKTLLRCPSKKKYKAIRLIFVIMVVFFIFWTPYN-LVLLFSAFQSIFFET 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 41054914 297 SCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15185 238 DCERSKHLDLAMQVTEVIAYTHCCINPVIYAFVGERFRKYL 278
7tmA_CCR1 cd15183
CC chemokine receptor type 1, member of the class A family of seven-transmembrane G ...
61-337 1.55e-48

CC chemokine receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR1 is widely expressed on both hematopoietic and non-hematopoietic cells and binds to the inflammatory CC chemokines CCL3, CCL5, CCL6, CCL9, CCL15, and CCL23. CCR1 activates the typical chemokine signaling pathway through the G(i/o) type of G proteins, causing inhibition of adenylate cyclase and stimulation of phospholipase C, PKC, calcium flux, and PLA2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320311  Cd Length: 278  Bit Score: 168.13  E-value: 1.55e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWA-YSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15183   3 LPPLYSLVFIIGVVGNVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLFTLPFWIdYKLKDDWIFGDAMCKFLSGFYYLG 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAhrHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEA 219
Cdd:cd15183  83 LYSEIFFIILLTIDRYLAIVHAVFA--LRARTVTFGIITSIITWALAILASMPCLYFFKSQWEFTHHTCSAHFPRKSLIR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 LIAIQVAQM-VVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNsSC 298
Cdd:cd15183 161 WKRFQALKLnLLGLILPLLVMIICYTGIINILLRRPNEKKAKAVRLIFVITLLFFLLWTPYNLAAFVSAFQDVLFTP-SC 239
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 41054914 299 EASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15183 240 EQSQQLDLALQVTEVIAYTHCCVNPVIYVFVGERFRKYL 278
7tmA_ACKR2_D6 cd15188
atypical chemokine receptor 2, member of the class A family of seven-transmembrane G ...
60-337 2.00e-48

atypical chemokine receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR2 (also known as D6) binds non-selectively to all inflammatory CC-chemokines, but not to homeostatic CC-chemokines involved in controlling the migration of cells. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320316  Cd Length: 278  Bit Score: 167.65  E-value: 2.00e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYI-YFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15188   2 FLPVFYTLVFLLGLAGNLLLFVVLLlYVPKKKKMTEVYLLNLAVSDLLFLVTLPFWAMYVAWHWVFGSFLCKFVSTLYTI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLliSKLSCIGIWTLAFFLSIPELLYSGLQKNSgEDTWRCSLVSAQVE 218
Cdd:cd15188  82 NFYSGIFFVSCMSLDKYLEIVHAQSPHRLRTRRK--SLLVLVAVWVLSIALSVPDMVFVQTHHTN-NGVWVCHADYGGHH 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 AL--IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNs 296
Cdd:cd15188 159 TIwkLVFQFQQNLLGFLFPLLAMVFFYSRIACVLTRLRPPGQGRALRFVAALVVVFFVLWFPYNLTLFLHSLQDLHVIG- 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 41054914 297 SCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15188 238 NCERSRHLDYALQVTESLAFVHCCLNPLLYAFVSKRFRLYL 278
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
75-326 8.17e-48

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 165.56  E-value: 8.17e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914    75 GNGLVVLTYIYFKRLKTMTDTYLLNLAVADILF-LMILPFWAYSEAK-SWIFGAYLCKSIFGIYKLSFFSGMLLLLCISI 152
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFlLLTLPFWLVYALFgTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   153 DRYVAIVQAVSAHRHRARVLLIsklsCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEALIAIQVAQMVVGF 232
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRRAKAI----ILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   233 VLPMLAMSFCYLVIIRTLLQ------ARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSCEasKQLNI 306
Cdd:pfam00001 157 LLPLLVILVCYTRIIRTLRKqarsrrRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVV--TPPRT 234
                         250       260
                  ....*....|....*....|
gi 41054914   307 AYDVTYSLASVRCCVNPFLY 326
Cdd:pfam00001 235 LLQLTVWLAYSNSCLNPIIY 254
7tmA_XCR1 cd15182
XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
60-337 3.25e-46

XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; XCR1 is a chemokine receptor specific for XCL1 and XCL2 (previously called lymphotatctin alpha/beta), which differ in only two amino acids. XCL1/2 is the only member of the C chemokine subfamily, which is unique as containing only two of the four cysteines that are found in other chemokine families. Human XCL1/2 has been shown to be secreted by activated CD8+ T cells and upon activation of the innate immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 320310  Cd Length: 271  Bit Score: 161.76  E-value: 3.25e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15182   2 FLPVFYYLVFLLSLLGNGLVLWILVKYEKLKTLTNIFILNLAISDLLFTFTLPFWASYHSSGWIFGEILCKAVTSIFYIG 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLIskLSCIGIWTLAFFLSIPELLYSGLQKnSGEDTWRCSLVSAQvEA 219
Cdd:cd15182  82 FYSSILFLTLMTIDRYLAVVHPLSALRSRKLRYAS--LVSVAVWVISILASLPELILSTVMK-SDEDGSLCEYSSIW-WK 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 LIAIQvaQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNssCE 299
Cdd:cd15182 158 LGYYY--QQNLFFLIPLGIIVYCYVRILQTLMRTRTMRKHRTVKLIFVIVLVFFLSWAPYNIVIFLRSLKDLTIPI--CE 233
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 41054914 300 ASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15182 234 CSKQLDYAFYICRNIAFSHCCLNPVFYVFVGVKFRNHL 271
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
60-334 3.43e-46

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 320116  Cd Length: 284  Bit Score: 162.17  E-value: 3.43e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAK--SWIFGAYLCKSIFGIYK 137
Cdd:cd14985   2 VIPAFYIAIFLVGLLGNLFVVWLFLLPRGPKRVADIFIANLAAADLVFVLTLPLWATYTANqyDWPFGDFLCKVSSYAIT 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVllISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQV 217
Cdd:cd14985  82 VNMFASVFLLTCMSVDRYLAIVHPVASRRLRRRR--QARVTCALIWVVACLLSLPTFLLRSLQALPDLNKTACIELYPHE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQ------ARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANF 291
Cdd:cd14985 160 AWHVGLSLVLNILGFVLPLVIILTCYCHIARTLRThyertgKGGRKRRKSLKIIFAVVVAFLVCWLPFHVFKFLDFLAQL 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|...
gi 41054914 292 NITNsSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd14985 240 GAIR-PCFWEAFLDLGLPIATCLAFTNSCLNPFIYVFFDRRFR 281
7tmA_CX3CR1 cd15186
CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G ...
60-337 3.95e-44

CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CX3CR1 is an inflammatory receptor specific for CX3CL1 (also known as fractalkine in human), which is involved in the adhesion and migration of leukocytes. The CX3C chemokine subfamily is only represented by CX3CL1, which exists in both soluble and membrane-anchored forms. Membrane-anchored form promotes strong adhesion of receptor-bearing leukocytes to CX3CL1-expressing endothelial cells. On the other hand, soluble CX3CL1, which is released by the proteolytic cleavage of membrane-anchored CX3CL1, is a potent chemoattractant for CX3CR1-expressing T cells and monocytes. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 320314  Cd Length: 273  Bit Score: 156.15  E-value: 3.95e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15186   2 FLSIFYSLVFAFGLVGNLLVVLALTNSGKSKSITDIYLLNLALSDLLFVATLPFWTHYLINEWGLHNAMCKLTTAFFFIG 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAvsAHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSgedtwrCSLVSAQVEA 219
Cdd:cd15186  82 FFGGIFFITVISIDRYLAIVLA--ANSMNNRTVQHGVTISLGVWAAAILVAVPQFMFTKMKENE------CLGDYPEVLQ 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 LI---AIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITnS 296
Cdd:cd15186 154 EIwpvLRNVELNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKARAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFF-P 232
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 41054914 297 SCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15186 233 SCDMKKDLRLALSVTETIAFSHCCLNPLIYAFAGEKFRRYL 273
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
60-337 1.20e-42

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320113  Cd Length: 283  Bit Score: 152.42  E-value: 1.20e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKS--WIFGAYLCKSIFGIYK 137
Cdd:cd14982   2 LFPIVYSLIFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLFVLTLPFRIYYYLNGgwWPFGDFLCRLTGLLFY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVsaHRHRARVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTwRC-SLVSAQ 216
Cdd:cd14982  82 INMYGSILFLTCISVDRYLAVVHPL--KSRRLRRKRYAVGVCAGVWILVLAASVPLLLLRSTIAKENNST-TCfEFLSEW 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 217 VEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQ-----LPYNGVVLAQTVANF 291
Cdd:cd14982 159 LASAAPLVLIALVVGFLIPLLIILVCYSLIIRALRRRSKQSQKSVRKRKALRMILIVLAVflvcfLPYHVTRILYLLVRL 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 41054914 292 NItNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd14982 239 SV-IADCSARNSLYKAYRITLCLASLNSCLDPLIYYFLSKTFRKRL 283
7tmA_CCR8 cd15187
CC chemokine receptor type 8, member of the class A family of seven-transmembrane G ...
60-337 5.77e-42

CC chemokine receptor type 8, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR8, the receptor for the CC chemokines CCL1 and CC16, is highly expressed on allergen-specific T-helper type 2 cells, and is implicated in the pathogenesis of human asthma. CCL1- and CCR8-expressing CD4+ effector T lymphocytes are shown to have a critical role in lung mucosal inflammatory responses. CCR8 is also a functional receptor for CCL16, a liver-expressed CC chemokine that involved in attracting lymphocytes, dendritic cells, and monocytes. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320315  Cd Length: 276  Bit Score: 150.33  E-value: 5.77e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:cd15187   2 FLPVLYCLLFVFGLLGNSLVIWVLVACKKLRSMTDVYLLNLAASDLLFVFSLPFQAYYLLDQWVFGNAMCKIVSGAYYIG 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAVSAhrHRARVLLISKLSCIGIWTLAFFLSIPELLYsgLQKNSGEDTWRCSLVSAQVEA 219
Cdd:cd15187  82 FYSSMFFITLMSIDRYLAIVHAVYA--LKVRTASHGTILSLALWLVAILASVPLLVF--YQVASEDGRLQCIPFYPGQGN 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 220 L--IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNsS 297
Cdd:cd15187 158 SwkVFTNFEVNILGLLIPFSILIFCYHNILRNLRRCHNQNKTKAIKLVFIVVIVFFLFWTPFNVVLFLDSLHSLHIID-G 236
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 41054914 298 CEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15187 237 CQNSQRLTLALHLTETISFTHCCLNPVIYAFVGEKFKKHL 276
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
61-337 3.53e-40

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320  Cd Length: 285  Bit Score: 146.04  E-value: 3.53e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKS--WIFGAYLCKSIFGIYKL 138
Cdd:cd15192   3 IPTVYSIIFVIGIFGNSLVVIVIYCYMKLKTVANIFLLNLALADLCFLITLPLWAAYTAMGyhWPFGNFLCKISSTLVSF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHraRVLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLV--SAQ 216
Cdd:cd15192  83 NLYASVFLLTCLSIDRYLAIVHPMKSRIR--RTLVVARVTCIVIWLLAGVASLPAIIFRDVFFYENWNKTVCAFHypNQN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 217 VEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNK-----AIKVIIAVVVVFVVFQLPYNGVVLAQTVANF 291
Cdd:cd15192 161 KQLLVGMGLMKNLLGFLIPFLIILTCYTLIGKTLKQAYQIQRSKsrndeIFKMIMAVVLFFFFCWIPHQVFTFLDVLIQL 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 41054914 292 NITnSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15192 241 KVI-QNCHILEIVDTAMPFTICIAYFNSCLNPILYGFVGKNFRKKF 285
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
60-334 1.57e-39

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101  Cd Length: 282  Bit Score: 143.97  E-value: 1.57e-39
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEA-KSWIFGAYLCKSIFGIYKL 138
Cdd:cd14970   2 VIPAVYSVVCVVGLTGNSLVIYVILRYSKMKTVTNIYILNLAVADELFLLGLPFLATSYLlGYWPFGEVMCKIVLSVDAY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRArvLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGeDTWRCSL---VSA 215
Cdd:cd14970  82 NMFTSIFCLTVMSVDRYLAVVHPVKSLRFRT--PRKAKLVSLCVWALSLVLGLPVIIFARTLQEEG-GTISCNLqwpDPP 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 216 QVEALIAIqVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFE----------RNKAIKVIIAVVVVFVVFQLPYNGVVLA 285
Cdd:cd14970 159 DYWGRVFT-IYTFVLGFAVPLLVITVCYSLIIRRLRSSRNLStsgarekrraRRKVTRLVLVVVAVFVVCWLPFHVFQIV 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*....
gi 41054914 286 QTVANFNITNSsceaskQLNIAYDVTySLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd14970 238 RLLIDPPETLT------VVGVFLFCI-ALSYANSCLNPILYAFLDENFR 279
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
38-344 6.85e-39

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021  Cd Length: 417  Bit Score: 145.16  E-value: 6.85e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   38 TVDYTLYESVCFKK-DVRNFKAW-----FLPLMYSVICFVGLLGNGLVVlTYIYFKRLKTMTDTYLLNLAVADILFLMIL 111
Cdd:PHA02638  72 TYDYEYENNITYELiNIKNKCMYpsiseYIKIFYIIIFILGLFGNAAII-MILFCKKIKTITDIYIFNLAISDLIFVIDF 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  112 PFWAYSEAKSWIFGAYLCKSIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHraRVLLISKLSCIGIWTLAFFLSI 191
Cdd:PHA02638 151 PFIIYNEFDQWIFGDFMCKVISASYYIGFFSNMFLITLMSIDRYFAILYPISFQKY--RTFNIGIILCIISWILSLIITS 228
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  192 P--------ELLYSGLQKNSGEDTWRCSLVSAQVEALIA-----IQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFER 258
Cdd:PHA02638 229 PayfifeasNIIFSAQDSNETISNYQCTLIEDNEKNNISflgriLQFEINILGMFIPIIIFAFCYIKIILKLKQLKKSKK 308
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  259 NKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFN-----ITNSSCEASKqLNIAYDVTYSLASVRCCVNPFLYAFIGVKF 333
Cdd:PHA02638 309 TKSIIIVSIIIICSLICWIPLNIVILFATMYSFKgfnsiISEHICGFIK-LGYAMMLAEAISLTHCCINPLIYTLIGENF 387
                        330
                 ....*....|.
gi 41054914  334 RSDLFKLFKDL 344
Cdd:PHA02638 388 RMHLLMIFRNI 398
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
63-328 4.37e-36

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 134.33  E-value: 4.37e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  63 LMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILF-LMILPFWAYSEA-KSWIFGAYLCKSIFGIYKLSF 140
Cdd:cd00637   3 VLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVgLLVIPFSLVSLLlGGWWFGDALCKLLGFLQTVSL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 141 FSGMLLLLCISIDRYVAIVQAVSAHRHRARvlLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGedTWRCSLVSAQVEAL 220
Cdd:cd00637  83 TASILTLTAISVDRYLAIVHPLRYRRRFTK--RRAKLVIALIWLLSLLLALPPLLGWKVYEYGG--YCCCCLCWPDLTLS 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 221 IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQ--------------LPYNGVVLAQ 286
Cdd:cd00637 159 KAYTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRKRISSSSNSSRRRRRRRERKVTkmllivvvvfllcwLPYFILFLLD 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 41054914 287 TVANFNitnssceaSKQLNIAYDVTYSLASVRCCVNPFLYAF 328
Cdd:cd00637 239 VFGPDP--------SPLPRILYFLALLLAYLNSAINPIIYAF 272
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
61-335 6.64e-36

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 320318  Cd Length: 292  Bit Score: 134.50  E-value: 6.64e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKS--WIFGAYLCKSIFGIYKL 138
Cdd:cd15190   3 IPVIYMLVFVLGLSGNGLVIWTVFRSKAKRRSADTFIANLALADLTFVVTLPLWAVYTALGyhWPFGSFLCKLSSYLVFV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLIskLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRC-----SLV 213
Cdd:cd15190  83 NMYASVFCLTCLSFDRYLAIVRSLASAKLRSRTSGI--VALGVIWLLAGLLALPALILRTTRELDGSNKTICdmdfsGVV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 214 SAQVEAL--IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLlqARNFE--------RNKAIKVIIAVVVVFVVFQLPYNGVV 283
Cdd:cd15190 161 SNEAELFwiAGLGLSSTVLGFLLPFLVMLTCYFFIGRTV--ARHFSkerkelkkKRRLLKIIITLVVTFALCWLPFHLVK 238
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|..
gi 41054914 284 LAQTVANFNITNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRS 335
Cdd:cd15190 239 TIYALMYLGILPFSCGFDQFLVNAHPYATCLAYVNSCLNPFLYAFFDPRFRQ 290
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
59-335 1.95e-35

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105  Cd Length: 274  Bit Score: 132.81  E-value: 1.95e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVltYIY-FKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKS--WIFGAYLCKSIFGI 135
Cdd:cd14974   1 IVSLVLYALIFLLGLPGNGLVI--WVAgFKMKRTVNTVWFLNLALADFLFCLFLPFLIVYIAMGhhWPFGSVLCKLNSFV 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 136 YKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHRaRVLLISKLsCIGIWTLAFFLSIPELLYSGLQ--KNSGEDTWRCSLV 213
Cdd:cd14974  79 ISLNMFASVFLLTAISLDRCLLVLHPVWAQNHR-TVRLASVV-CVGIWILALVLSVPYFVFRDTVthHNGRSCNLTCVED 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 214 SAQVE-ALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFN 292
Cdd:cd14974 157 YDLRRsRHKALTVIRFLCGFLLPLLIIAICYSVIAVKLRRKRLAKSSKPLRVLLAVVVAFFLCWLPYHVFALLELVAAAG 236
                       250       260       270       280
                ....*....|....*....|....*....|....*....|...
gi 41054914 293 ITNSsceaskqLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRS 335
Cdd:cd14974 237 LPEV-------VLLGLPLATGLAYFNSCLNPILYVFMGQDFRK 272
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
61-328 3.44e-34

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320095  Cd Length: 270  Bit Score: 129.06  E-value: 3.44e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILF-LMILPFWA-YSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd14964   1 LFVLLLLIFLLGLLGNLLVLLVILRSRRLRTPTNLFLLNLALADLLFsLVVVPFLLlGLLSGEWSFGFAGCKLVLFFFYL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLliSKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVE 218
Cdd:cd14964  81 FGFASIFLLTAMAIDRYLAICHPLKYTVLMTPRR--ARLLILGIWVLSLLLSLPPLLGWGTLPFCGPNVPLLTLSCSDTA 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 ALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVF---------QLPYNGVVLAQTva 289
Cdd:cd14964 159 WNIAYTLGLLILGFLLPLLLILVSYARIVRALLRRKRITRSAISSARRERKAFKTLLivvlvfllcWLPYHIVYLLPA-- 236
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 41054914 290 nfnitnsSCEASKQLNIAYDVTYSLASVRCCVNPFLYAF 328
Cdd:cd14964 237 -------LLQLSNSLPLLLLLSVLLAVLNSCLNPLIYSL 268
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
59-334 5.82e-34

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321  Cd Length: 279  Bit Score: 128.72  E-value: 5.82e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  59 WFLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKS--WIFGAYLCKSIFGIY 136
Cdd:cd15193   1 IYIPILYLIIFFTGLLGNLFVIALMSKRSTTKRLVDTFVLNLAVADLVFVLTLPFWAASTALGgqWLFGEGLCKLSSFII 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 137 KLSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLIskLSCIGIWTLAFFLSIPELLYSGLQKNS--GEDTwrcslvs 214
Cdd:cd15193  81 AVNRCSSILFLTGMSVDRYLAVVKLLDSRPLRTRRCAL--ITCCIIWAVSLVLGIPSLVYRNLINESvcVEDS------- 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 215 aQVEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTL------LQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTV 288
Cdd:cd15193 152 -SSRFFQGISLATLFLTFVLPLIVILFCYCSILVRLrrhfhgAKRTGRRRRNSLRIVFAIVTAFVLSWLPFNTLKAVRLL 230
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 41054914 289 ANFNITNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15193 231 LELGGGVLPCHTTVAIRQGLTITACLAFVNSCVNPLIYSLLDRHFR 276
7tmA_ACKR3_CXCR7 cd14987
CXC chemokine receptor 7, member of the class A family of seven-transmembrane G ...
61-337 1.72e-33

CXC chemokine receptor 7, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR3, also known as CXCR7, is an atypical chemokine receptor for CXCL12 and CXCR11. Unlike the classical chemokine receptors, ACKR3 contains a DRYLSIT-sequence instead of the conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. Thus, ACKR3 does not activate classical GPCR signaling, instead induces beta-arrestin recruitment which is leading to ligand internalization and MAP-kinase activation. It is acting as a scavenger for CXCL12 and, to a lesser degree, for CXCL11. ACKR3 is highly expressed by blood vascular endothelial cells in brain, in numerous embryonic and neonatal tissues, in inflamed tissues and in a variety of cancers such as lymphomas, sarcomas, prostate and breast cancers, and gliomas. Five receptors have been identified for the ACKR family, including CC-Chemokine Receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, DARC, and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320118  Cd Length: 282  Bit Score: 127.57  E-value: 1.72e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYS--EAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd14987   3 LSFFYIFIFVIGLLANSVVVWVNLQAKRTGYETHLYILNLAIADLCVVATLPVWVVSlvQHNQWPMGEFTCKITHLIFSI 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVllISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQ-- 216
Cdd:cd14987  83 NLFGSIFFLTCMSVDRYLSVTLFGNTSSRRKKI--VRRIICVLVWLLAFVASLPDTYFLKTVTSPSNNETYCRSFYPEes 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 217 -VEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITN 295
Cdd:cd14987 161 fKEWLIGMELVSIVLGFVIPFPIIAVFYFLLARAISASSDQERKSSRKIIFSYVVVFLVCWLPYHTVVLLDILSFLHLIP 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 41054914 296 SSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd14987 241 FSCQLENFLYAALHVTQCFSLVHCCVNPILYSFINRNYRYEL 282
7tmA_Bradykinin_R cd15189
bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
61-334 2.40e-33

bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320317  Cd Length: 284  Bit Score: 127.20  E-value: 2.40e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWA--YSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15189   3 IPPFIFSLCLFGLLGNLFVLLVFLLHRRRLTVAEIYLGNLAAADLVFVSGLPFWAmnILNQFNWPFGELLCRVVNGVIKV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARvlLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVE 218
Cdd:cd15189  83 NLYTSIYLLVMISQDRYLALVKTMAARRLRRR--RYAKLICVLIWVVGLLLSIPTFLLRKIKAIPDLNITACVLLYPHEA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 ALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFER------NKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFN 292
Cdd:cd15189 161 WHFAHIVLLNIVGFLLPLLVITFCNYNILQALRTREESTRcedrndSKATALVLAVTLLFLVCWGPYHFFTFLDFLFDVG 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 41054914 293 ITnSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15189 241 VL-DECFWEHFIDIGLQLAVFLAFSNSCLNPVLYVFVGRYFR 281
7tmA_RNL3R cd14976
relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G ...
63-337 7.34e-33

relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This G protein-coupled receptor subfamily is composed of the relaxin-3 like peptide receptors, RNL3R1 and RNL3R2, and similar proteins. The relaxin-3 like peptide family includes relaxin-1, -2, -3, as well as insulin-like (INSL) peptides 3 to 6. RNL3/relaxin-3 and INSL5 are the endogenous ligands for RNL3R1 and RNL3R2, respectively. RNL3R1, also called GPCR135 or RXFP3, is predominantly expressed in the brain and is implicated in stress, anxiety, feeding, and metabolism. Insulin-like peptide 5 (INSL5), the endogenous ligand for RNL3R2 (also called GPCR142 or RXFP4), plays a role in fat and glucose metabolism. INSL5 is highly expressed in human rectal and colon tissues. Both RNL3R1 and RNL3R2 signal through G(i) protein and inhibit adenylate cyclase, thereby inhibit cAMP accumulation. RNL3R1 is shown to activate Erk1/2 signaling pathway.


Pssm-ID: 320107  Cd Length: 290  Bit Score: 126.08  E-value: 7.34e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  63 LMYSVICFVGLLGNGLVVLTYIYFKRLKTM--TDTYLLNLAVADILFLMILPFWAYSEA--KSWIFGAYLCKSIFGIYKL 138
Cdd:cd14976   5 VVYMVVFTVGLLGNLLVLYLLKSNKKLRQQseSNKFVFNLALTDLIFVLTLPFWAVEYAldFVWPFGTAMCKVVRYVTKL 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRArvLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTW------RCSL 212
Cdd:cd14976  85 NMYSSIFFLTALSVTRYIAVARALKHGWIRK--AFGAFATTIAIWAAAALAAIPEAIFSTDTWSSVNHTLcllrfpKNSS 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 213 VSAQVEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTL---LQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVA 289
Cdd:cd14976 163 VTRWYNWLGMYQLQKVVLGFFLPLGIITLSYLLLLRFLqrkRGGSKRRKSRVTKSVFIVVLSFFICWLPNQALSLWSALI 242
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 41054914 290 NFNITNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd14976 243 KFDDVPFSDAFFAFQTYAFPVAICLAHSNSCLNPVLYCLVRREFRDAL 290
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
61-342 1.58e-32

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 126.05  E-value: 1.58e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   61 LPLMYSVICFVGLLGNgLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAY-SEAKSWIFGAYLCKSIFGIYKLS 139
Cdd:PHA03087  43 LIVVYSTIFFFGLVGN-IIVIYVLTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYyYILFQWSFGEFACKIVSGLYYIG 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  140 FFSGMLLLLCISIDRYVAIVQAVSAHRHRArvLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSgEDTWRCSLVSAQVEA 219
Cdd:PHA03087 122 FYNSMNFITVMSVDRYIAIVHPVKSNKINT--VKYGYIVSLVIWIISIIETTPILFVYTTKKDH-ETLICCMFYNNKTMN 198
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  220 L-IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIK-VIIAVVVVFVVFQLPYNGVVLAQTVANFNITnSS 297
Cdd:PHA03087 199 WkLFINFEINIIGMLIPLTILLYCYSKILITLKGINKSKKNKKAIkLVLIIVILFVIFWLPFNVSVFVYSLHILHFK-SG 277
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 41054914  298 CEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKLFK 342
Cdd:PHA03087 278 CKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKSLK 322
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
61-334 6.86e-32

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221  Cd Length: 280  Bit Score: 122.96  E-value: 6.86e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAKS-WIFGAYLCKSIFGIYKLS 139
Cdd:cd15093   3 IPCIYAVVCLVGLCGNSLVIYVVLRYAKMKTVTNIYILNLAIADELFMLGLPFLAASNALRhWPFGSVLCRLVLSVDGIN 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 140 FFSGMLLLLCISIDRYVAIVQAV-SAHRHRARVlliSKLSCIGIWTLAFFLSIPELLYSGLQKNsGEDTWRCSLVSAQVE 218
Cdd:cd15093  83 MFTSIFCLTVMSVDRYLAVVHPIkSARWRRPRV---AKVVNLAVWVASLLVILPVVVFAGTREN-QDGSSACNMQWPEPA 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 A--LIAIQVAQMVVGFVLPMLAMSFCYLVII--------RTLLQARNFERNKAIKVIIAVVVVFVVFQLPYngvvlaqtv 288
Cdd:cd15093 159 AawSAGFIIYTFVLGFLLPLLIICLCYLLIVikvksaglRAGWQQRKRSERKVTRMVVMVVVVFVICWLPF--------- 229
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 41054914 289 ANFNITNSSCEASKQ--LNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15093 230 YVLQLVNVFVQLPETpaLVGVYHFVVILSYANSCANPILYGFLSDNFK 277
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
61-337 1.64e-31

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216  Cd Length: 278  Bit Score: 121.79  E-value: 1.64e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEA--KSWIFGAYLCKSIFGIYKL 138
Cdd:cd15088   3 MPSVFGCICVVGLVGNGIVLYVLVRCSKLRTAPDIFIFNLAVADLLFMLGMPFLIHQFAidGQWYFGEVMCKIITALDAN 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARvlLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWrCSLVSAQVE 218
Cdd:cd15088  83 NQFTSTYILTAMSVDRYLAVVHPIRSTKYRTR--FVAKLVNVGLWAASFLSILPVWVYSSLIYFPDGTTF-CYVSLPSPD 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 ALIAIQVAQMVVGFVLPMLAMSFCYLVII----RTLLQAR----NFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVAN 290
Cdd:cd15088 160 DLYWFTIYHFILGFAVPLVVITVCYILILhrlaRGVAPGNqshgSSRTKRVTKMVILIVVVFIVCWLPFHVVQLVNLAMN 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 41054914 291 fnitnsscEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15088 240 --------RPTLAFEVAYFLSICLGYANSCLNPFVYILVSENFRKRL 278
7tmA_AT2R cd15191
type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
60-337 1.49e-30

type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320319  Cd Length: 286  Bit Score: 119.47  E-value: 1.49e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWA--YSEAKSWIFGAYLCKSIFGIYK 137
Cdd:cd15191   2 AIPVLYSIIFILGFLGNSLVVCVLCHQSGPKTVANIYILNLAVADLLFLATLPLWAvyYSLGYNWLFGSVMCKICGSLLT 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLliSKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQV 217
Cdd:cd15191  82 LNLYASIFFITCMSVDRYLAIVYPLRSQRRRSPRQ--ARLVCLLVWVLACLSSLPTFYFRDTYYIEELGVTACIMDYPNE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EAL---IAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQ-----LPYNGVVLAQTVA 289
Cdd:cd15191 160 EYAqwsAGLALMKNTLGFLLPLIVIATCYCGIGRHLLATKGFGLNKQRRDKVLKLVAAVVLAflicwFPFHVLTFLDALA 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 41054914 290 NFNITNsSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15191 240 RMGVIN-NCWVITVIDKALPFAICLGFSNSCINPFLYCFVGNHFREKL 286
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
60-250 2.24e-30

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222  Cd Length: 282  Bit Score: 118.73  E-value: 2.24e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEA-KSWIFGAYLCKSIFGIYKL 138
Cdd:cd15094   2 ISAVLYGLICIVGLVGNGLVIYVVLRYAKMKTVTNLYILNLAVADECFLIGLPFLIVTMIlKYWPFGAAMCKIYMVLTSI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRArvLLISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTwrCSLV---SA 215
Cdd:cd15094  82 NQFTSSFTLTVMSADRYLAVCHPIRSMRYRT--PFIAKVVCATTWSISFLVMLPIILYASTVPDSGRYS--CTIVwpdSS 157
                       170       180       190
                ....*....|....*....|....*....|....*
gi 41054914 216 QVEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTL 250
Cdd:cd15094 158 AVNGQKAFTLYTFLLGFAIPLLLISVFYTLVILRL 192
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
60-337 7.26e-30

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331  Cd Length: 293  Bit Score: 117.32  E-value: 7.26e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILF-LMILPF-WAYSEAKSWIFGAYLCKSIFGIYK 137
Cdd:cd15203   2 ILILLYGLIIVLGVVGNLLVIYVVLRNKSMQTVTNIFILNLAVSDLLLcLVSLPFtLIYTLTKNWPFGSILCKLVPSLQG 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVqavsaHRHRARVLLISKLSCI-GIWTLAFFLSIPELLYSGLQKNSGEDTWR----CSL 212
Cdd:cd15203  82 VSIFVSTLTLTAIAIDRYQLIV-----YPTRPRMSKRHALLIIaLIWILSLLLSLPLAIFQELSDVPIEILPYcgyfCTE 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 213 VSAQVEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTlLQARNFERNKAIKVIIAVVVVFVVFQLPYN----GVVLAQTV 288
Cdd:cd15203 157 SWPSSSSRLIYTISVLVLQFVIPLLIISFCYFRISLK-LRKRVKKKRGKRTLSSRRRRSELRRKRRTNrlliAMVVVFAV 235
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 41054914 289 AN-----FNITN----SSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15203 236 CWlplnlFNLLRdfepLPQIDGRHFYLIFLICHLIAMSSACVNPLLYGWLNDNFRKEF 293
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
60-334 7.46e-30

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 320296  Cd Length: 283  Bit Score: 117.42  E-value: 7.46e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEA--KSWIFGAYLCKSIFGIYK 137
Cdd:cd15168   2 FLPIVYGVVFLVGLLLNAVVLYRFIFSLKPWNSSAIYMFNLAVSDLLYLLSLPFLIYYYAngDHWIFGDFMCKLVRFLFY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLliSKLSCIGIWTLAFFLSIPELLYSGL-QKNSGEDTWRCSLvSAQ 216
Cdd:cd15168  82 FNLYCSILFLTCISVHRYLGICHPMRSLRKLKKRH--AVAVCVAVWILVLLQLLPILFFATTgRPNNRTTCYDTTS-PEE 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 217 VEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQ-----ARNFERNKAIKVIIAVVVVFVVFQLPYNgVVLAQTVANF 291
Cdd:cd15168 159 LNDYVPYSMVLTGLGFLLPLLIILACYGLIARTLLRslgsgVTSALRRKSIRLVIVVLALFAVCFLPFH-VTRTIYLAAR 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|...
gi 41054914 292 NITNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15168 238 LLSGTSCATLNGIYVAYKVTRPLASLNSCLNPLLYFLTGDKFR 280
7tmA_CysLTR cd15921
cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G ...
60-337 9.21e-30

cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320587  Cd Length: 283  Bit Score: 116.83  E-value: 9.21e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWA--YSEAKSWIFGAYLCKSIFGIYK 137
Cdd:cd15921   2 FYPTAYILIFILGLTGNSISVYVFLSQYRSQTPVSVLMVNLAISDLLLVCTLPLRLtyYVLNSHWPFGDIACRIILYVLY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVsaHRHRARVLLISKLSCIGIWTLAFFLSIPeLLYSGLQKNSGEDTWRCSLVSAQV 217
Cdd:cd15921  82 VNMYSSIYFLTALSVFRYLALVWPY--LYLRVQTHSVAGIICGLIWILMGLASSP-LLFAKSKQHDEGSTRCLELAHDAV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFE------RNKAIKVIIAVVVVFVVFQLPYNgVVLAQTVANF 291
Cdd:cd15921 159 DKLLLINYVTLPVGFVVPFMTVIFCYIFIIKNLLKPSPALgrtrpsRRKACALIIISLGIFLVCFLPYH-IVRTIHLITE 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 41054914 292 NITNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDL 337
Cdd:cd15921 238 RQIKESCGYILRVRKAAVITLCLAASNSCFDPLLYFFVGENFRSRL 283
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
35-346 1.06e-29

chemokine receptor-like protein; Provisional


Pssm-ID: 165177  Cd Length: 323  Bit Score: 117.70  E-value: 1.06e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914   35 ENTTV--DYTLY-ESVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVVlTYIYFKRLKTMTDTYLLNLAVADILFLMIL 111
Cdd:PHA02834   2 ETTVVvdNYSYYfEEECDFEMVNSDVNYFVIVFYILLFIFGLIGNVLVI-AVLIVKRFMFVVDVYLFNIAMSDLMLVFSF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  112 PFWAYSEAKSWIFGAYLCKSIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVsahRHRARVLLISKLSCIGIWTLAFFLSI 191
Cdd:PHA02834  81 PFIIHNDLNEWIFGEFMCKLVLGVYFVGFFSNMFFVTLISIDRYILVVNAT---KIKNKSISLSVLLSVAAWVCSVILSM 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  192 PELLYSGLQKNSGEDTWRCSLVSAQVEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVV 271
Cdd:PHA02834 158 PAMVLYYVDNTDNLKQCIFNDYHENFSWSAFFNFEINIFGIVIPLIILIYCYSKILYTLKNCKNKNKTRSIKIILTVVTF 237
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 41054914  272 FVVFQLPYNGVVLAQTVANFNITNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFrsdlFKLFKDLGC 346
Cdd:PHA02834 238 TVVFWVPFNIVLFINSLQSVGLIDIGCYHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNF----KKVFKNMFC 308
7tmA_SSTR4 cd15973
somatostatin receptor type 4, member of the class A family of seven-transmembrane G ...
64-247 1.11e-29

somatostatin receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR4 plays a critical role in mediating inflammation. Unlike other SSTRs, SSTR4 subtype is not detected in all pituitary adenomas while it is expressed in the normal human pituitary.


Pssm-ID: 320639  Cd Length: 274  Bit Score: 116.49  E-value: 1.11e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  64 MYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEA-KSWIFGAYLCKSIFGIYKLSFFS 142
Cdd:cd15973   6 IYALVCLVGLIGNSMVIFVILRYAKMKTATNIYILNLAIADELFMLSVPFLAASAAlQHWPFGSAMCRTVLSVDGINMFT 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 143 GMLLLLCISIDRYVAIVQAVSAHRHRARVllISKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTwRCSLVSAQVEALIA 222
Cdd:cd15973  86 SVFCLTVLSVDRYIAVVHPLRAARYRRPT--VAKMINICVWILSLLVISPIIIFADTATRKGQAV-ACNLIWPHPAWSAA 162
                       170       180
                ....*....|....*....|....*
gi 41054914 223 IQVAQMVVGFVLPMLAMSFCYLVII 247
Cdd:cd15973 163 FVIYTFLLGFLLPVLAIGLCYILII 187
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
60-334 1.13e-29

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636  Cd Length: 276  Bit Score: 116.55  E-value: 1.13e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFW-AYSEAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15970   2 LISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLvTSTLLRHWPFGSLLCRLVLSVDAI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVllISKLSCIGIWTLAFFLSIPELLYSGLQKNSgEDTWRCSLVSAQVE 218
Cdd:cd15970  82 NMFTSIYCLTVLSIDRYIAVVHPIKAARYRRPT--VAKMVNLGVWVFSILVILPIIIFSNTAPNS-DGSVACNMQMPEPS 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 219 A--LIAIQVAQMVVGFVLPMLAMSFCYLVIIRTL--------LQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTV 288
Cdd:cd15970 159 QrwLAVFVVYTFLMGFLLPVIAICLCYILIIVKMrvvalkagWQQRKRSERKITLMVMMVVTVFVICWMPFYVVQLVSVF 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 41054914 289 ANFNITNSSceaskQLNIAydvtysLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15970 239 VGQHDATVS-----QLSVI------LGYANSCANPILYGFLSDNFK 273
7tmA_CMKLR1 cd15116
chemokine-like receptor 1, member of the class A family of seven-transmembrane G ...
60-334 1.33e-29

chemokine-like receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine receptor-like 1 (also known as Chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. CMKLR1 is prominently expressed in dendritic cells and macrophages.


Pssm-ID: 320244  Cd Length: 284  Bit Score: 116.40  E-value: 1.33e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTyIYFKRLKTMTDTYLLNLAVADILFLMILPF-WAYSEAKS-WIFGAYLCKSIFGIYK 137
Cdd:cd15116   2 LSMVIYSVVFVLGVLGNGLVIFI-TGFKMKKTVNTVWFLNLAVADFLFTFFLPFsIAYTAMDFhWPFGRFMCKLNSFLLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLliSKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRC------- 210
Cdd:cd15116  81 LNMFTSVFLLTVISIDRCISVVFPVWSQNHRSVRL--ASLVSLAVWVVAFFLSSPSFIFRDTAPSQNNNKIICfnnfsls 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 211 ------SLVSAQVEALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVL 284
Cdd:cd15116 159 gdnsspEVNQLRNMRHQVMTITRFLLGFLIPFTIIICCYAAIVLKLKRNRLAKSSKPFKIIAAVIVTFFLCWAPYHILNL 238
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|
gi 41054914 285 AQTVANFNItnssceaSKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15116 239 LEMEATRSP-------ASVFKIGLPITSSLAFINSCLNPILYVFMGQDFK 281
7tmA_BK-2 cd15381
bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled ...
60-334 3.34e-29

bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320503  Cd Length: 284  Bit Score: 115.25  E-value: 3.34e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  60 FLPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWA--YSEAKSWIFGAYLCKSIFGIYK 137
Cdd:cd15381   2 FQPIYLWIIFVLGTIENAFVLIVFCLHKSSCTVAEIYLGNLAAADLLLVCCLPFWAinISNGFNWPFGEFLCKSVNAVIY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 138 LSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLliSKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQV 217
Cdd:cd15381  82 MNLYSSIYFLMMVSIDRYLALVKTMSSGRMRRPAC--AKLNCLIIWMFGLLMSTPMIVFRTVMYFPEYNITACVLDYPSE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 218 EALIAIQVAQMVVGFVLPMLAMSFCYLVIIRTL-------LQARNFERNKAIKVIIAVVVVFVVFqLPYNGVVLAQTVAN 290
Cdd:cd15381 160 GWHVALNILLNVVGFLIPLSIITFCSTQIIQVLrnnkmqkFKEIQTERKATVLVLAVLLMFFICW-LPFHIFTFLDTLHK 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 41054914 291 FNItNSSCEASKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFR 334
Cdd:cd15381 239 LGL-ISGCRWEDILDIGTQIATFLAYSNSCLNPLLYVIVGKHFR 281
7tmA_LTB4R2 cd15122
leukotriene B4 receptor subtype 2 (LTB4R2 or BLT2), member of the class A family of ...
70-341 8.59e-29

leukotriene B4 receptor subtype 2 (LTB4R2 or BLT2), member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the Gq-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320250  Cd Length: 281  Bit Score: 114.13  E-value: 8.59e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  70 FVGLLGNGLVVLTYIYF--KRLKTMTDTYLLNLAVADILFLMILPFW-AYSEAKSWIFGAYLCKSIFGIYKLSFFSGMLL 146
Cdd:cd15122  12 LLGLPGNGFIIWSILWKmkARGRSVTCILILNLAVADGAVLLLTPFFiTFLTRKTWPFGQAVCKAVYYLCCLSMYASIFI 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 147 LLCISIDRYVAIVQAVSAHRHRARVLLISKLscIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEALIAIQVA 226
Cdd:cd15122  92 IGLMSLDRCLAVTRPYLAQSLRKKALVRKIL--LAIWLLALLLALPAFVYRHVWKDEGMNDRICEPCHASRGHAIFHYTF 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 227 QMVVGFVLPMLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSCEASKQLNI 306
Cdd:cd15122 170 ETLVAFVLPFGVILFSYSVILVRLKGARFRRRARVEKLIAAIVVAFALLWVPYHVVNLLQVVANLAPGEVLEKLGGAAKA 249
                       250       260       270
                ....*....|....*....|....*....|....*
gi 41054914 307 AYDVTYSLASVRCCVNPFLYAFIGvkfrSDLFKLF 341
Cdd:cd15122 250 ARAGATALAFFSSSVNPLLYVFAA----GDLIKTS 280
7tmA_BK-1 cd15380
bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled ...
61-335 1.61e-28

bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320502  Cd Length: 286  Bit Score: 113.36  E-value: 1.61e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914  61 LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYS--EAKSWIFGAYLCKSIFGIYKL 138
Cdd:cd15380   3 LPTFIIAICFFGLLGNLFVLFVFLLPRRRLTIAEIYLANLAASDLVFVLGLPFWAENirNQFNWPFGNFLCRVISGVIKA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054914 139 SFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLliSKLSCIGIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVE 218
Cdd:cd15380  83 NLFISIFLVVAISQDRYRTLVHTMTSRRQRSRRQ--AQVICLLIWVFGGLLSIPTFLFRSVKHVPDLNISACILLFPHEA 160