NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|408536127|pdb|4HAEA| ]
View 

Chain A, Crystal Structure Of The Cdyl2-Chromodomain

Protein Classification

CHROMO domain-containing protein (domain architecture ID 10645401)

CHROMO domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CHROMO smart00298
Chromatin organization modifier domain;
24-72 5.61e-15

Chromatin organization modifier domain;


:

Pssm-ID: 214605  Cd Length: 55  Bit Score: 64.54  E-value: 5.61e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
4HAEA          24 YEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEF 72
Cdd:smart00298  2 YEVEKILDHRWKKKGELEYLVKWKGYSYSEDTWEPEENLLNCSKKLDNY 50
 
Name Accession Description Interval E-value
CHROMO smart00298
Chromatin organization modifier domain;
24-72 5.61e-15

Chromatin organization modifier domain;


Pssm-ID: 214605  Cd Length: 55  Bit Score: 64.54  E-value: 5.61e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
4HAEA          24 YEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEF 72
Cdd:smart00298  2 YEVEKILDHRWKKKGELEYLVKWKGYSYSEDTWEPEENLLNCSKKLDNY 50
Chromo pfam00385
Chromo (CHRromatin Organisation MOdifier) domain;
24-73 1.01e-13

Chromo (CHRromatin Organisation MOdifier) domain;


Pssm-ID: 306815  Cd Length: 54  Bit Score: 61.11  E-value: 1.01e-13
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
4HAEA         24 YEVERIVDKRKNKKG-KWEYLIRWKGYGSTEDTWEPEHHLLHC-EEFIDEFN 73
Cdd:pfam00385  1 YEVERILDHRLVKKGnKLQYLVKWKGLPYDEATWEPEENLRDCfPELIQAFG 52
CHROMO cd00024
Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids ...
22-73 1.77e-13

Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus. Experimental evidence implicates the chromo domain in the binding activity of these proteins to methylated histone tails and maybe RNA. May occur as single instance, in a tandem arrangement or followd by a related "chromo shadow" domain.


Pssm-ID: 237991  Cd Length: 55  Bit Score: 60.36  E-value: 1.77e-13
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|...
4HAEA       22 DLYEVERIVDKRKNKK-GKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFN 73
Cdd:cd00024  1 EEYEVEKILDHRKKKDgGEYEYLVKWKGYSYSEDTWEPEENLEDCKELIDEFK 53
 
Name Accession Description Interval E-value
CHROMO smart00298
Chromatin organization modifier domain;
24-72 5.61e-15

Chromatin organization modifier domain;


Pssm-ID: 214605  Cd Length: 55  Bit Score: 64.54  E-value: 5.61e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
4HAEA          24 YEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEF 72
Cdd:smart00298  2 YEVEKILDHRWKKKGELEYLVKWKGYSYSEDTWEPEENLLNCSKKLDNY 50
Chromo pfam00385
Chromo (CHRromatin Organisation MOdifier) domain;
24-73 1.01e-13

Chromo (CHRromatin Organisation MOdifier) domain;


Pssm-ID: 306815  Cd Length: 54  Bit Score: 61.11  E-value: 1.01e-13
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
4HAEA         24 YEVERIVDKRKNKKG-KWEYLIRWKGYGSTEDTWEPEHHLLHC-EEFIDEFN 73
Cdd:pfam00385  1 YEVERILDHRLVKKGnKLQYLVKWKGLPYDEATWEPEENLRDCfPELIQAFG 52
CHROMO cd00024
Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids ...
22-73 1.77e-13

Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus. Experimental evidence implicates the chromo domain in the binding activity of these proteins to methylated histone tails and maybe RNA. May occur as single instance, in a tandem arrangement or followd by a related "chromo shadow" domain.


Pssm-ID: 237991  Cd Length: 55  Bit Score: 60.36  E-value: 1.77e-13
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|...
4HAEA       22 DLYEVERIVDKRKNKK-GKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFN 73
Cdd:cd00024  1 EEYEVEKILDHRKKKDgGEYEYLVKWKGYSYSEDTWEPEENLEDCKELIDEFK 53
Mtf2_C pfam14061
Polycomb-like MTF2 factor 2; Mammalian Polycomb-like gene MTF2/PCL2 forms a complex with ...
13-49 6.59e-03

Polycomb-like MTF2 factor 2; Mammalian Polycomb-like gene MTF2/PCL2 forms a complex with Polycomb repressive complex-2 (PRC2) and collaborates with PRC1 to achieve repression of Hox gene expression. The human MTF2 gene is expressed in three splicing variants, each of them contains the short C-terminal domain defined here. The domain is subject to structure determination by the Joint Center of Structural Genomics.


Pssm-ID: 316574  Cd Length: 47  Bit Score: 31.18  E-value: 6.59e-03
                         10        20        30
                 ....*....|....*....|....*....|....*....
4HAEA         13 NLYFqGASGDLYEVER--IVDKRKNKKGKWEYLIRWKGY 49
Cdd:pfam14061 10 NSYF-GAANRIACGERfaVLAKRVTPNGKVQYLIEWEGA 47
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH