NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402913804|ref|XP_003919349|]
View 

PREDICTED: signal transducer CD24-like [Papio anubis]

Protein Classification

CD24 domain-containing protein (domain architecture ID 10633181)

CD24 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CD24 pfam14984
CD24 protein;
26-77 2.99e-14

CD24 protein;


:

Pssm-ID: 317405  Cd Length: 52  Bit Score: 63.79  E-value: 2.99e-14
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 402913804   26 SNQTTVVTVSSNSSQSTSTAPNPANATTKAVGGALQSTASLFVVSLSLLHLY 77
Cdd:pfam14984   1 SNQTTVVTLSSNSSQNTSAAPNPANATTKAGGGALQSTASLFVISLSLLHLY 52
 
Name Accession Description Interval E-value
CD24 pfam14984
CD24 protein;
26-77 2.99e-14

CD24 protein;


Pssm-ID: 317405  Cd Length: 52  Bit Score: 63.79  E-value: 2.99e-14
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 402913804   26 SNQTTVVTVSSNSSQSTSTAPNPANATTKAVGGALQSTASLFVVSLSLLHLY 77
Cdd:pfam14984   1 SNQTTVVTLSSNSSQNTSAAPNPANATTKAGGGALQSTASLFVISLSLLHLY 52
 
Name Accession Description Interval E-value
CD24 pfam14984
CD24 protein;
26-77 2.99e-14

CD24 protein;


Pssm-ID: 317405  Cd Length: 52  Bit Score: 63.79  E-value: 2.99e-14
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 402913804   26 SNQTTVVTVSSNSSQSTSTAPNPANATTKAVGGALQSTASLFVVSLSLLHLY 77
Cdd:pfam14984   1 SNQTTVVTLSSNSSQNTSAAPNPANATTKAGGGALQSTASLFVISLSLLHLY 52
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH