NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402873270|ref|XP_003900505|]
View 

tetratricopeptide repeat protein 1 [Papio anubis]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PLN03088 super family cl26005
SGT1, suppressor of G2 allele of SKP1; Provisional
57-254 1.38e-12

SGT1, suppressor of G2 allele of SKP1; Provisional


The actual alignment was detected with superfamily member TIGR00990:

Pssm-ID: 330826  Cd Length: 615  Bit Score: 67.32  E-value: 1.38e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270   57 QAEEECFHDCSASFEEEPGADKIENKSNedvnSSELDEEYLIelekNMSDEEkqkRREESTRLKEEGNEQFKKGDYIEAE 136
Cdd:TIGR00990  79 QAEKETEGKTEEKKSTAPKNAPVEPADE----LPEIDESSVA----NLSEEE---RKKYAAKLKEKGNKAYRNKDFNKAI 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270  137 SSYSRALEMcpccfqKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYK-SI 215
Cdd:TIGR00990 148 KLYSKAIEC------KPDPVYYSNRAACHNALGDWEKVVEDTTAALELDPDYSKALNRRANAYDGLGKYADALLDLTaSC 221
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 402873270  216 LEKDPSVHQAREACMRLPKQIEErnERLKEEMLGKLKDL 254
Cdd:TIGR00990 222 IIDGFRNEQSAQAVERLLKKFAE--SKAKEILETKPENL 258
 
Name Accession Description Interval E-value
3a0801s09 TIGR00990
mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) ...
57-254 1.38e-12

mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273380  Cd Length: 615  Bit Score: 67.32  E-value: 1.38e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270   57 QAEEECFHDCSASFEEEPGADKIENKSNedvnSSELDEEYLIelekNMSDEEkqkRREESTRLKEEGNEQFKKGDYIEAE 136
Cdd:TIGR00990  79 QAEKETEGKTEEKKSTAPKNAPVEPADE----LPEIDESSVA----NLSEEE---RKKYAAKLKEKGNKAYRNKDFNKAI 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270  137 SSYSRALEMcpccfqKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYK-SI 215
Cdd:TIGR00990 148 KLYSKAIEC------KPDPVYYSNRAACHNALGDWEKVVEDTTAALELDPDYSKALNRRANAYDGLGKYADALLDLTaSC 221
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 402873270  216 LEKDPSVHQAREACMRLPKQIEErnERLKEEMLGKLKDL 254
Cdd:TIGR00990 222 IIDGFRNEQSAQAVERLLKKFAE--SKAKEILETKPENL 258
PLN03088 PLN03088
SGT1, suppressor of G2 allele of SKP1; Provisional
119-247 3.51e-07

SGT1, suppressor of G2 allele of SKP1; Provisional


Pssm-ID: 215568  Cd Length: 356  Bit Score: 50.56  E-value: 3.51e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270 119 LKEEGNEQFKKGDYIEAESSYSRALEMCPCCFQkersiLFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAEL 198
Cdd:PLN03088   5 LEDKAKEAFVDDDFALAVDLYTQAIDLDPNNAE-----LYADRAQANIKLGNFTEAVADANKAIELDPSLAKAYLRKGTA 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 402873270 199 YEKtdkldeaLEDY---KSILEKDPSVHQAREacmRLPKQIEERNERLKEEM 247
Cdd:PLN03088  80 CMK-------LEEYqtaKAALEKGASLAPGDS---RFTKLIKECDEKIAEEE 121
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
110-221 5.11e-04

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 40.60  E-value: 5.11e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270 110 QKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPccfqKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYI 189
Cdd:COG0457  161 PELNELAEALLALGALLEALGRYEEALELLEKALKLNP----DDDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDNA 236
                         90       100       110
                 ....*....|....*....|....*....|..
gi 402873270 190 RAILRRAELYEKTDKLDEALEDYKSILEKDPS 221
Cdd:COG0457  237 EALYNLALLLLELGRYEEALEALEKALELDPD 268
TPR_1 pfam00515
Tetratricopeptide repeat;
158-188 6.67e-04

Tetratricopeptide repeat;


Pssm-ID: 306905  Cd Length: 34  Bit Score: 37.79  E-value: 6.67e-04
                          10        20        30
                  ....*....|....*....|....*....|.
gi 402873270  158 FSNRAAARMKQDKKEMAINDCSKAIQLNPSY 188
Cdd:pfam00515   4 LYNLGNAYFKLGKYDEALEYYEKALELNPNN 34
TPR smart00028
Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum ...
158-188 3.32e-03

Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.


Pssm-ID: 197478  Cd Length: 34  Bit Score: 35.50  E-value: 3.32e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 402873270   158 FSNRAAARMKQDKKEMAINDCSKAIQLNPSY 188
Cdd:smart00028   4 LYNLGNAYLKLGDYDEALEYYEKALELDPNN 34
 
Name Accession Description Interval E-value
3a0801s09 TIGR00990
mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) ...
57-254 1.38e-12

mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273380  Cd Length: 615  Bit Score: 67.32  E-value: 1.38e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270   57 QAEEECFHDCSASFEEEPGADKIENKSNedvnSSELDEEYLIelekNMSDEEkqkRREESTRLKEEGNEQFKKGDYIEAE 136
Cdd:TIGR00990  79 QAEKETEGKTEEKKSTAPKNAPVEPADE----LPEIDESSVA----NLSEEE---RKKYAAKLKEKGNKAYRNKDFNKAI 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270  137 SSYSRALEMcpccfqKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYK-SI 215
Cdd:TIGR00990 148 KLYSKAIEC------KPDPVYYSNRAACHNALGDWEKVVEDTTAALELDPDYSKALNRRANAYDGLGKYADALLDLTaSC 221
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 402873270  216 LEKDPSVHQAREACMRLPKQIEErnERLKEEMLGKLKDL 254
Cdd:TIGR00990 222 IIDGFRNEQSAQAVERLLKKFAE--SKAKEILETKPENL 258
PLN03088 PLN03088
SGT1, suppressor of G2 allele of SKP1; Provisional
119-247 3.51e-07

SGT1, suppressor of G2 allele of SKP1; Provisional


Pssm-ID: 215568  Cd Length: 356  Bit Score: 50.56  E-value: 3.51e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270 119 LKEEGNEQFKKGDYIEAESSYSRALEMCPCCFQkersiLFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAEL 198
Cdd:PLN03088   5 LEDKAKEAFVDDDFALAVDLYTQAIDLDPNNAE-----LYADRAQANIKLGNFTEAVADANKAIELDPSLAKAYLRKGTA 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 402873270 199 YEKtdkldeaLEDY---KSILEKDPSVHQAREacmRLPKQIEERNERLKEEM 247
Cdd:PLN03088  80 CMK-------LEEYqtaKAALEKGASLAPGDS---RFTKLIKECDEKIAEEE 121
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
127-220 8.84e-06

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 47.00  E-value: 8.84e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270  127 FKKGDYIEAESSYSRALEMCPCCFQKersilFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLD 206
Cdd:TIGR02917 476 LGKGDLAKAREAFEKALSIEPDFFPA-----AANLARIDIQEGNPDDAIQRFEKVLTIDPKNLRAILALAGLYLRTGNEE 550
                          90
                  ....*....|....
gi 402873270  207 EALEDYKSILEKDP 220
Cdd:TIGR02917 551 EAVAWLEKAAELNP 564
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
110-221 5.11e-04

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 40.60  E-value: 5.11e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270 110 QKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPccfqKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYI 189
Cdd:COG0457  161 PELNELAEALLALGALLEALGRYEEALELLEKALKLNP----DDDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDNA 236
                         90       100       110
                 ....*....|....*....|....*....|..
gi 402873270 190 RAILRRAELYEKTDKLDEALEDYKSILEKDPS 221
Cdd:COG0457  237 EALYNLALLLLELGRYEEALEALEKALELDPD 268
TPR_1 pfam00515
Tetratricopeptide repeat;
158-188 6.67e-04

Tetratricopeptide repeat;


Pssm-ID: 306905  Cd Length: 34  Bit Score: 37.79  E-value: 6.67e-04
                          10        20        30
                  ....*....|....*....|....*....|.
gi 402873270  158 FSNRAAARMKQDKKEMAINDCSKAIQLNPSY 188
Cdd:pfam00515   4 LYNLGNAYFKLGKYDEALEYYEKALELNPNN 34
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
123-250 8.63e-04

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 40.45  E-value: 8.63e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270  123 GNEQFKKGDYIEAESSYSRALEMCPccfqkerSILFSNRAAARMK--QDKKEMAINDCSKAIQLNPSYIRAILRRAELYE 200
Cdd:TIGR02917 132 GLAYLGLGQLELAQKSYEQALAIDP-------RSLYAKLGLAQLAlaENRFDEARALIDEVLTADPGNVDALLLKGDLLL 204
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 402873270  201 KTDKLDEALEDYKSILE---KDPSVHqAREACMRLPKQIEERNERLKEEMLGK 250
Cdd:TIGR02917 205 SLGNIELALAAYRKAIAlrpNNIAVL-LALATILIEAGEFEEAEKHADALLKK 256
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
123-245 2.29e-03

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 39.30  E-value: 2.29e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270  123 GNEQFKKGDYIEAESSYSRALEMCPccfqkERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKT 202
Cdd:TIGR02917 370 GEAYLALGDFEKAAEYLAKATELDP-----ENAAARTQLGISKLSQGDPSEAIADLETAAQLDPELGRADLLLILSYLRS 444
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 402873270  203 DKLDEALEDYKSILEK---DPSVHQAREACMRLPKQIEERNERLKE 245
Cdd:TIGR02917 445 GQFDKALAAAKKLEKKqpdNASLHNLLGAIYLGKGDLAKAREAFEK 490
TPR smart00028
Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum ...
158-188 3.32e-03

Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.


Pssm-ID: 197478  Cd Length: 34  Bit Score: 35.50  E-value: 3.32e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 402873270   158 FSNRAAARMKQDKKEMAINDCSKAIQLNPSY 188
Cdd:smart00028   4 LYNLGNAYLKLGDYDEALEYYEKALELDPNN 34
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
91-245 3.39e-03

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 38.29  E-value: 3.39e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270  91 ELDEEYLIELEKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPCCFQKERSILfsNRAAARMKQDK 170
Cdd:COG0457  105 LEALGKYEEALELLEKALALDPDPDLAEALLALGALYELGDYEEALELYEKALELDPELNELAEALL--ALGALLEALGR 182
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 402873270 171 KEMAINDCSKAIQLNPSYIRAILR-RAELYEKTDKLDEALEDYKSILEKDPSVHQAREACMRLPKQIEERNERLKE 245
Cdd:COG0457  183 YEEALELLEKALKLNPDDDAEALLnLGLLYLKLGKYEEALEYYEKALELDPDNAEALYNLALLLLELGRYEEALEA 258
PRK11788 PRK11788
tetratricopeptide repeat protein; Provisional
162-237 5.58e-03

tetratricopeptide repeat protein; Provisional


Pssm-ID: 236983  Cd Length: 389  Bit Score: 37.87  E-value: 5.58e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402873270 162 AAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYKSILEKDPS-----VHQAREACMRLPKQI 236
Cdd:PRK11788 187 AQQALARGDLDAARALLKKALAADPQCVRASILLGDLALAQGDYAAAIEALERVEEQDPEylsevLPKLMECYQALGDEA 266

                 .
gi 402873270 237 E 237
Cdd:PRK11788 267 E 267
TPR smart00028
Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum ...
189-221 9.82e-03

Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.


Pssm-ID: 197478  Cd Length: 34  Bit Score: 34.34  E-value: 9.82e-03
                           10        20        30
                   ....*....|....*....|....*....|...
gi 402873270   189 IRAILRRAELYEKTDKLDEALEDYKSILEKDPS 221
Cdd:smart00028   1 AEALYNLGNAYLKLGDYDEALEYYEKALELDPN 33
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH