NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402866391|ref|XP_003897368|]
View 

PREDICTED: POU domain, class 5, transcription factor 1 [Papio anubis]

Protein Classification

POU and homeodomain domain-containing protein (domain architecture ID 11265437)

POU and homeodomain domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
POU smart00352
Found in Pit-Oct-Unc transcription factors;
138-212 3.44e-45

Found in Pit-Oct-Unc transcription factors;


:

Pssm-ID: 197673  Cd Length: 75  Bit Score: 152.21  E-value: 3.44e-45
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 402866391   138 DIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEAD 212
Cdd:smart00352   1 DDDTDPRELEAFAKQFKQRRIKLGFTQADVGLALGALYGPAFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAE 75
Homeobox pfam00046
Homeobox domain;
233-286 2.91e-19

Homeobox domain;


:

Pssm-ID: 306543  Cd Length: 54  Bit Score: 81.01  E-value: 2.91e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 402866391  233 KRTSIENRVRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGK 286
Cdd:pfam00046   1 KRTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
 
Name Accession Description Interval E-value
POU smart00352
Found in Pit-Oct-Unc transcription factors;
138-212 3.44e-45

Found in Pit-Oct-Unc transcription factors;


Pssm-ID: 197673  Cd Length: 75  Bit Score: 152.21  E-value: 3.44e-45
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 402866391   138 DIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEAD 212
Cdd:smart00352   1 DDDTDPRELEAFAKQFKQRRIKLGFTQADVGLALGALYGPAFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAE 75
Pou pfam00157
Pou domain - N-terminal to homeobox domain;
144-212 4.45e-40

Pou domain - N-terminal to homeobox domain;


Pssm-ID: 306631  Cd Length: 69  Bit Score: 138.46  E-value: 4.45e-40
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 402866391  144 KELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEAD 212
Cdd:pfam00157   1 EELEEFAEEFKQRRIKLGLTQADVGRALGALYGNVFSQSTICRFEALDLSFKNMCKLKPLLEKWLEEAE 69
Homeobox pfam00046
Homeobox domain;
233-286 2.91e-19

Homeobox domain;


Pssm-ID: 306543  Cd Length: 54  Bit Score: 81.01  E-value: 2.91e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 402866391  233 KRTSIENRVRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGK 286
Cdd:pfam00046   1 KRTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
230-286 3.07e-16

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 73.05  E-value: 3.07e-16
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 402866391   230 RKRKRTSIENRVRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGK 286
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
231-289 9.13e-16

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 71.89  E-value: 9.13e-16
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 402866391 231 KRKRTSIENRVRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS 289
Cdd:cd00086    1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKRSE 59
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
208-290 5.44e-06

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863  Cd Length: 156  Bit Score: 45.51  E-value: 5.44e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402866391 208 VEEADNN---ENLQEICKAETlvqaRKRKRTSIENRVRgsLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQK 284
Cdd:COG5576   32 VEAADSEmklERKQDGSSPPK----SKRRRTTDEQLMV--LEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAK 105

                 ....*.
gi 402866391 285 GKRSSS 290
Cdd:COG5576  106 EKKKRS 111
 
Name Accession Description Interval E-value
POU smart00352
Found in Pit-Oct-Unc transcription factors;
138-212 3.44e-45

Found in Pit-Oct-Unc transcription factors;


Pssm-ID: 197673  Cd Length: 75  Bit Score: 152.21  E-value: 3.44e-45
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 402866391   138 DIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEAD 212
Cdd:smart00352   1 DDDTDPRELEAFAKQFKQRRIKLGFTQADVGLALGALYGPAFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAE 75
Pou pfam00157
Pou domain - N-terminal to homeobox domain;
144-212 4.45e-40

Pou domain - N-terminal to homeobox domain;


Pssm-ID: 306631  Cd Length: 69  Bit Score: 138.46  E-value: 4.45e-40
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 402866391  144 KELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEAD 212
Cdd:pfam00157   1 EELEEFAEEFKQRRIKLGLTQADVGRALGALYGNVFSQSTICRFEALDLSFKNMCKLKPLLEKWLEEAE 69
Homeobox pfam00046
Homeobox domain;
233-286 2.91e-19

Homeobox domain;


Pssm-ID: 306543  Cd Length: 54  Bit Score: 81.01  E-value: 2.91e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 402866391  233 KRTSIENRVRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGK 286
Cdd:pfam00046   1 KRTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
230-286 3.07e-16

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 73.05  E-value: 3.07e-16
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 402866391   230 RKRKRTSIENRVRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGK 286
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
231-289 9.13e-16

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 71.89  E-value: 9.13e-16
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 402866391 231 KRKRTSIENRVRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS 289
Cdd:cd00086    1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKRSE 59
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
208-290 5.44e-06

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863  Cd Length: 156  Bit Score: 45.51  E-value: 5.44e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402866391 208 VEEADNN---ENLQEICKAETlvqaRKRKRTSIENRVRgsLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQK 284
Cdd:COG5576   32 VEAADSEmklERKQDGSSPPK----SKRRRTTDEQLMV--LEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAK 105

                 ....*.
gi 402866391 285 GKRSSS 290
Cdd:COG5576  106 EKKKRS 111
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH