NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402794740|ref|NP_113830|]
View 

Krueppel-like factor 6 [Rattus norvegicus]

Protein Classification

similar to protein odd-skipped-related (domain architecture ID 10442949)

protein similar to protein odd-skipped-related

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
280-305 3.22e-05

Zinc-finger double domain;


:

Pssm-ID: 290200  Cd Length: 26  Bit Score: 40.46  E-value: 3.22e-05
                          10        20
                  ....*....|....*....|....*.
gi 402794740  280 ELTRHFRKHTGAKPFKCSHCDRCFSR 305
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPVCGKSFAR 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
250-266 5.19e-03

Zinc-finger double domain;


:

Pssm-ID: 290200  Cd Length: 26  Bit Score: 34.29  E-value: 5.19e-03
                          10
                  ....*....|....*..
gi 402794740  250 HLKAHQRTHTGEKPYRC 266
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKC 17
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
234-258 8.20e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


:

Pssm-ID: 278523  Cd Length: 23  Bit Score: 33.43  E-value: 8.20e-03
                          10        20
                  ....*....|....*....|....*
gi 402794740  234 HRCHfnGCRKVYTKSSHLKAHQRTH 258
Cdd:pfam00096   1 YKCP--DCGKSFSRKSNLKRHLRTH 23
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
211-299 7.10e-05

FOG: Zn-finger [General function prediction only];


:

Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 42.76  E-value: 7.10e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402794740 211 SGTSGKSGDKGSGDASPDGRRRVHRCHFNGCRKvyTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTG 290
Cdd:COG5048   11 SNNSVLSSTPKSTLKSLSNAPRPDSCPNCTDSF--SRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHN 88

                 ....*....
gi 402794740 291 AKPFKCSHC 299
Cdd:COG5048   89 NPSDLNSKS 97
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
280-305 3.22e-05

Zinc-finger double domain;


Pssm-ID: 290200  Cd Length: 26  Bit Score: 40.46  E-value: 3.22e-05
                          10        20
                  ....*....|....*....|....*.
gi 402794740  280 ELTRHFRKHTGAKPFKCSHCDRCFSR 305
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPVCGKSFAR 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
250-266 5.19e-03

Zinc-finger double domain;


Pssm-ID: 290200  Cd Length: 26  Bit Score: 34.29  E-value: 5.19e-03
                          10
                  ....*....|....*..
gi 402794740  250 HLKAHQRTHTGEKPYRC 266
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKC 17
ZnF_C2H2 smart00355
zinc finger;
294-316 6.99e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 33.98  E-value: 6.99e-03
                           10        20
                   ....*....|....*....|...
gi 402794740   294 FKCSHCDRCFSRSDHLALHMKRH 316
Cdd:smart00355   1 YRCPECGKVFKSKSALREHMRTH 23
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
234-258 8.20e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 278523  Cd Length: 23  Bit Score: 33.43  E-value: 8.20e-03
                          10        20
                  ....*....|....*....|....*
gi 402794740  234 HRCHfnGCRKVYTKSSHLKAHQRTH 258
Cdd:pfam00096   1 YKCP--DCGKSFSRKSNLKRHLRTH 23
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
211-299 7.10e-05

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 42.76  E-value: 7.10e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402794740 211 SGTSGKSGDKGSGDASPDGRRRVHRCHFNGCRKvyTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTG 290
Cdd:COG5048   11 SNNSVLSSTPKSTLKSLSNAPRPDSCPNCTDSF--SRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHN 88

                 ....*....
gi 402794740 291 AKPFKCSHC 299
Cdd:COG5048   89 NPSDLNSKS 97
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
280-305 3.22e-05

Zinc-finger double domain;


Pssm-ID: 290200  Cd Length: 26  Bit Score: 40.46  E-value: 3.22e-05
                          10        20
                  ....*....|....*....|....*.
gi 402794740  280 ELTRHFRKHTGAKPFKCSHCDRCFSR 305
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPVCGKSFAR 26
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
294-316 3.41e-05

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 278523  Cd Length: 23  Bit Score: 40.36  E-value: 3.41e-05
                          10        20
                  ....*....|....*....|...
gi 402794740  294 FKCSHCDRCFSRSDHLALHMKRH 316
Cdd:pfam00096   1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
250-266 5.19e-03

Zinc-finger double domain;


Pssm-ID: 290200  Cd Length: 26  Bit Score: 34.29  E-value: 5.19e-03
                          10
                  ....*....|....*..
gi 402794740  250 HLKAHQRTHTGEKPYRC 266
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKC 17
ZnF_C2H2 smart00355
zinc finger;
294-316 6.99e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 33.98  E-value: 6.99e-03
                           10        20
                   ....*....|....*....|...
gi 402794740   294 FKCSHCDRCFSRSDHLALHMKRH 316
Cdd:smart00355   1 YRCPECGKVFKSKSALREHMRTH 23
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
234-258 8.20e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 278523  Cd Length: 23  Bit Score: 33.43  E-value: 8.20e-03
                          10        20
                  ....*....|....*....|....*
gi 402794740  234 HRCHfnGCRKVYTKSSHLKAHQRTH 258
Cdd:pfam00096   1 YKCP--DCGKSFSRKSNLKRHLRTH 23
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
211-299 7.10e-05

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 42.76  E-value: 7.10e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402794740 211 SGTSGKSGDKGSGDASPDGRRRVHRCHFNGCRKvyTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTG 290
Cdd:COG5048   11 SNNSVLSSTPKSTLKSLSNAPRPDSCPNCTDSF--SRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHN 88

                 ....*....
gi 402794740 291 AKPFKCSHC 299
Cdd:COG5048   89 NPSDLNSKS 97
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
122-289 3.36e-03

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 37.39  E-value: 3.36e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402794740 122 DSLISSGFNYNLETNSLNsdvssessdsseelsPTT----KFTSDPIGEvlvNSGNLSSSVISTPPSSPEVNRESSQLwg 197
Cdd:COG5189  254 DDDILGPSNEEMLYKYIS---------------PSQgsaeLFEESSLGF---DYEFIHKSVGNKEIRGGISTGEMIDV-- 313
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402794740 198 cgpGDLPSPGkvrSGTSGKSGDKGSGDASPDGRR------RVHRCHFNGCRKVYTKSSHLKAH-------QRTH------ 258
Cdd:COG5189  314 ---RKLPCTN---SSSNGKLAHGGERNIDTPSRMlkvkdgKPYKCPVEGCNKKYKNQNGLKYHmlhghqnQKLHenpspe 387
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 402794740 259 ------TGEKPYRCswEGCEWRFARSDELTRHfRKHT 289
Cdd:COG5189  388 kmnifsAKDKPYRC--EVCDKRYKNLNGLKYH-RKHS 421
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
209-314 6.06e-03

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 36.62  E-value: 6.06e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402794740 209 VRSGTSGKSGDKGSGDASPDGRRRVHRCHfNGCRKVYTKSSHLKAhqrthTGEKPYRCSWEGCEWRFARSDELTRHfRKH 288
Cdd:COG5189  301 IRGGISTGEMIDVRKLPCTNSSSNGKLAH-GGERNIDTPSRMLKV-----KDGKPYKCPVEGCNKKYKNQNGLKYH-MLH 373
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 402794740 289 --------------------TGAKPFKCSHCDRCFSRSDHLALHMK 314
Cdd:COG5189  374 ghqnqklhenpspekmnifsAKDKPYRCEVCDKRYKNLNGLKYHRK 419
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH