NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|39996137|ref|NP_952088|]
View 

methyl-accepting chemotaxis sensory transducer, class 40H [Geobacter sulfurreducens PCA]

Protein Classification

methyl-accepting chemotaxis protein (domain architecture ID 11435591)

methyl-accepting chemotaxis protein (MCP) is a bacterial receptor that mediates chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behavior

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
180-547 1.56e-64

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


:

Pssm-ID: 223910  Cd Length: 408  Bit Score: 219.09  E-value: 1.56e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 180 VDVSTADVNAVLRSSLITTVVMGAVLFVAGTLLMLLVIRPVSAAVRMLAEKVNHVADGDLNVTVDYASGDELGMLAGDMN 259
Cdd:COG0840  44 LDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFN 123
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 260 RMVEKLRDMVAGVAGAAAEVTTAARQLSSTSEEMAAGVQSAAAEVVGVSTAGEEMAATSFEISFNCSTVAADARQATESA 339
Cdd:COG0840 124 EMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVA 203
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 340 TAGEEVVSATVCIMANIAALVrdsARTVESLGARSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEV 419
Cdd:COG0840 204 EEGGEEVRQAVEQMQEIAEEL---AEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEV 280
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 420 RALAERTARATREITAVIRSIQQETQGAVTAMTAGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTAT 499
Cdd:COG0840 281 RKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAV 360
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*...
gi 39996137 500 TTEISGNILRISDVVQSTTRGAQDSADAAAHLQGLAEELHAAVGRFRV 547
Cdd:COG0840 361 LEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
 
Name Accession Description Interval E-value
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
180-547 1.56e-64

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 219.09  E-value: 1.56e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 180 VDVSTADVNAVLRSSLITTVVMGAVLFVAGTLLMLLVIRPVSAAVRMLAEKVNHVADGDLNVTVDYASGDELGMLAGDMN 259
Cdd:COG0840  44 LDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFN 123
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 260 RMVEKLRDMVAGVAGAAAEVTTAARQLSSTSEEMAAGVQSAAAEVVGVSTAGEEMAATSFEISFNCSTVAADARQATESA 339
Cdd:COG0840 124 EMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVA 203
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 340 TAGEEVVSATVCIMANIAALVrdsARTVESLGARSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEV 419
Cdd:COG0840 204 EEGGEEVRQAVEQMQEIAEEL---AEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEV 280
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 420 RALAERTARATREITAVIRSIQQETQGAVTAMTAGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTAT 499
Cdd:COG0840 281 RKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAV 360
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*...
gi 39996137 500 TTEISGNILRISDVVQSTTRGAQDSADAAAHLQGLAEELHAAVGRFRV 547
Cdd:COG0840 361 LEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
285-546 3.48e-60

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 202.52  E-value: 3.48e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137    285 QLSSTSEEMAAGVQSAAAEVVGVSTAGEEMAATSFEISFNCSTVAADARQATESATAGEEVVSATVCIMANIAALVRDSA 364
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137    365 RTVESLGARSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATREITAVIRSIQQET 444
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137    445 QGAVTAMTAGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTATTTEISGNILRISDVVQSTTRGAQDS 524
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 39996137    525 ADAAAHLQGLAEELHAAVGRFR 546
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
312-525 2.45e-46

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 163.18  E-value: 2.45e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 312 EEMAATSFEISFNCSTVAADARQATESATAGEEVVSATVCIMANIAALVRDSARTVESLGARSDQIGELAGSIEDIADQT 391
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 392 NLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATREITAVIRSIQQETQGAVTAMTAGVVEVERGTAEASRSGEA 471
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 39996137 472 LRGILeriHAVEEQVVQIaaaadqqtattTEISGNILRISDVVQSTTRGAQDSA 525
Cdd:cd11386 161 FEEIV---ASVEEVADGI-----------QEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
353-545 2.95e-43

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 154.91  E-value: 2.95e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137   353 MANIAALVRDSARTVESLGARSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATRE 432
Cdd:pfam00015  15 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137   433 ITAVIRSIQQETQGAVTAMTAGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTATTTEISGNILRISD 512
Cdd:pfam00015  95 IEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQ 174
                         170       180       190
                  ....*....|....*....|....*....|...
gi 39996137   513 VVQSTTRGAQDSADAAAHLQGLAEELHAAVGRF 545
Cdd:pfam00015 175 VTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
227-547 1.26e-32

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 131.23  E-value: 1.26e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  227 LAEKVNHVADGDLNVTVDYASGDELGMLA-------GDMNRMVEKLRDMVAGVAGAAAEVTTAARQLSSTSEEMAAGVQS 299
Cdd:PRK15041 225 LIDSIRHIAGGDLVKPIEVDGSNEMGQLAeslrhmqGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEE 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  300 AAAEVvgvstagEEMAATSFEISFNCSTVAADARQATESATAGEEVVSATVCIMANIAAlvrdsartveslgaRSDQIGE 379
Cdd:PRK15041 305 TAASM-------EQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDIST--------------SSQKIAD 363
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  380 LAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATREITAVIRSiqqetqgavtamtaGVVEVE 459
Cdd:PRK15041 364 IISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIED--------------SVGKVD 429
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  460 RGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTATTTEISGNILRISDVVQSTTRGAQDSADAAAHLQGLAEELH 539
Cdd:PRK15041 430 VGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLT 509

                 ....*...
gi 39996137  540 AAVGRFRV 547
Cdd:PRK15041 510 EAVAVFRI 517
 
Name Accession Description Interval E-value
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
180-547 1.56e-64

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 219.09  E-value: 1.56e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 180 VDVSTADVNAVLRSSLITTVVMGAVLFVAGTLLMLLVIRPVSAAVRMLAEKVNHVADGDLNVTVDYASGDELGMLAGDMN 259
Cdd:COG0840  44 LDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFN 123
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 260 RMVEKLRDMVAGVAGAAAEVTTAARQLSSTSEEMAAGVQSAAAEVVGVSTAGEEMAATSFEISFNCSTVAADARQATESA 339
Cdd:COG0840 124 EMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVA 203
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 340 TAGEEVVSATVCIMANIAALVrdsARTVESLGARSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEV 419
Cdd:COG0840 204 EEGGEEVRQAVEQMQEIAEEL---AEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEV 280
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 420 RALAERTARATREITAVIRSIQQETQGAVTAMTAGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTAT 499
Cdd:COG0840 281 RKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAV 360
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*...
gi 39996137 500 TTEISGNILRISDVVQSTTRGAQDSADAAAHLQGLAEELHAAVGRFRV 547
Cdd:COG0840 361 LEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
285-546 3.48e-60

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 202.52  E-value: 3.48e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137    285 QLSSTSEEMAAGVQSAAAEVVGVSTAGEEMAATSFEISFNCSTVAADARQATESATAGEEVVSATVCIMANIAALVRDSA 364
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137    365 RTVESLGARSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATREITAVIRSIQQET 444
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137    445 QGAVTAMTAGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTATTTEISGNILRISDVVQSTTRGAQDS 524
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 39996137    525 ADAAAHLQGLAEELHAAVGRFR 546
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
312-525 2.45e-46

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 163.18  E-value: 2.45e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 312 EEMAATSFEISFNCSTVAADARQATESATAGEEVVSATVCIMANIAALVRDSARTVESLGARSDQIGELAGSIEDIADQT 391
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 392 NLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATREITAVIRSIQQETQGAVTAMTAGVVEVERGTAEASRSGEA 471
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 39996137 472 LRGILeriHAVEEQVVQIaaaadqqtattTEISGNILRISDVVQSTTRGAQDSA 525
Cdd:cd11386 161 FEEIV---ASVEEVADGI-----------QEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
353-545 2.95e-43

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 154.91  E-value: 2.95e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137   353 MANIAALVRDSARTVESLGARSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATRE 432
Cdd:pfam00015  15 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137   433 ITAVIRSIQQETQGAVTAMTAGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTATTTEISGNILRISD 512
Cdd:pfam00015  95 IEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQ 174
                         170       180       190
                  ....*....|....*....|....*....|...
gi 39996137   513 VVQSTTRGAQDSADAAAHLQGLAEELHAAVGRF 545
Cdd:pfam00015 175 VTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
227-547 1.26e-32

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 131.23  E-value: 1.26e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  227 LAEKVNHVADGDLNVTVDYASGDELGMLA-------GDMNRMVEKLRDMVAGVAGAAAEVTTAARQLSSTSEEMAAGVQS 299
Cdd:PRK15041 225 LIDSIRHIAGGDLVKPIEVDGSNEMGQLAeslrhmqGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEE 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  300 AAAEVvgvstagEEMAATSFEISFNCSTVAADARQATESATAGEEVVSATVCIMANIAAlvrdsartveslgaRSDQIGE 379
Cdd:PRK15041 305 TAASM-------EQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDIST--------------SSQKIAD 363
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  380 LAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTARATREITAVIRSiqqetqgavtamtaGVVEVE 459
Cdd:PRK15041 364 IISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIED--------------SVGKVD 429
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  460 RGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTATTTEISGNILRISDVVQSTTRGAQDSADAAAHLQGLAEELH 539
Cdd:PRK15041 430 VGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLT 509

                 ....*...
gi 39996137  540 AAVGRFRV 547
Cdd:PRK15041 510 EAVAVFRI 517
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
196-548 1.98e-31

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 127.82  E-value: 1.98e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  196 ITTVVMGAVLFVAGTLLMLLVIRPVSAAVRMLAEkvnhVADGDLNVTVDYASGDELGMLAGDMNRM-------VEKLRDM 268
Cdd:PRK15048 196 VIALVVVLILLVAWYGIRRMLLTPLAKIIAHIRE----IAGGNLANTLTIDGRSEMGDLAQSVSHMqrsltdtVTHVREG 271
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  269 VAGVAGAAAEVTTAARQLSSTSEEMAAGVQSAAAEVvgvstagEEMAATSFEISFNCSTVAADARQATESATAGEEVVSA 348
Cdd:PRK15048 272 SDAIYAGTREIAAGNTDLSSRTEQQASALEETAASM-------EQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDG 344
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  349 TVCIMANIAalvrDSartveslgarSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTAR 428
Cdd:PRK15048 345 VVKTMHEIA----DS----------SKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQ 410
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  429 ATREITAVIRSiqqetqgavtamtaGVVEVERGTAEASRSGEALRGILERIHAVEEQVVQIAAAADQQTATTTEISGNIL 508
Cdd:PRK15048 411 AAKEIKALIED--------------SVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVS 476
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 39996137  509 RISDVVQSTTRGAQDSADAAAHLQGLAEELHAAVGRFRVA 548
Cdd:PRK15048 477 EMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLA 516
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
192-488 2.25e-27

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 115.55  E-value: 2.25e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  192 RSSLI-TTVVMGAVLFVAGTLLML--LVIRPVSaavrMLAEKVNHVADGDLNVTVDYASGDELGMLAGDMNRMVEKLRDM 268
Cdd:PRK09793 187 ISALVfISMIIVAAIYISSALWWTrkMIVQPLA----IIGSHFDSIAAGNLARPIAVYGRNEITAIFASLKTMQQALRGT 262
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  269 VAGVAGAAAEVTTAARQLSSTSEEMAAGVQSAAAEVVGVSTAGEEMAATSFEISFNCSTVAADARQATESATAGEEVVSA 348
Cdd:PRK09793 263 VSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVST 342
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  349 TVCIMANIAAlvrdsartveslgaRSDQIGELAGSIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTAR 428
Cdd:PRK09793 343 MTHTMQEIAT--------------SSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQ 408
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 39996137  429 ATREITAVI-RSIQQETQGA---------VTAMTAGVVEVERGTAE-ASRSGEALRGILERIHAVEE--QVVQ 488
Cdd:PRK09793 409 AAKEIKGLIeESVNRVQQGSklvnnaaatMTDIVSSVTRVNDIMGEiASASEEQRRGIEQVAQAVSQmdQVTQ 481
HAMP pfam00672
HAMP domain;
199-267 2.78e-08

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 52.19  E-value: 2.78e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 39996137   199 VVMGAVLFVAGTLLMLLVIRPVSAAVRMLAEKVNHVADGDLNVTVDYaSGDELGMLAGDMNRMVEKLRD 267
Cdd:pfam00672   2 LLVLLIALLLALLLAWLLARRILRPLRRLAEAARRIASGDLDVPLES-GRDEIGELARAFNQMAERLRE 69
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
218-268 1.00e-06

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 47.24  E-value: 1.00e-06
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 39996137    218 RPVSAAVRMLAEKVNHVADGDLNVTVDYASGDELGMLAGDMNRMVEKLRDM 268
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEET 51
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
220-267 3.29e-06

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 45.70  E-value: 3.29e-06
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*...
gi 39996137 220 VSAAVRMLAEKVNHVADGDLNVTVDYASGDELGMLAGDMNRMVEKLRD 267
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLRE 48
NtrY COG5000
Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation ...
204-297 1.78e-05

Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms];


Pssm-ID: 227333  Cd Length: 712  Bit Score: 47.46  E-value: 1.78e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 204 VLFVAgTLLMLLVIRPVSAAVRMLAEKVNHVADGDLNVTVDYASGDEL-GMLAGDMNRMVEKLRDMVAGVAGAAAEVTTA 282
Cdd:COG5000 290 VLLAA-IWTAIAFARRIVRPIRKLIEAADEVADGDLDVQVPVRRVDEDvGRLSKAFNKMTEQLSSQQEALERAKDALEQR 368
                        90
                ....*....|....*
gi 39996137 283 ARQLSSTSEEMAAGV 297
Cdd:COG5000 369 RRFLEAVLSGLTAGV 383
PRK10549 PRK10549
signal transduction histidine-protein kinase BaeS; Provisional
210-265 4.05e-04

signal transduction histidine-protein kinase BaeS; Provisional


Pssm-ID: 182539  Cd Length: 466  Bit Score: 42.70  E-value: 4.05e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137  210 TLLMLLVIRPVS----AAVRMLAEKVNHVADGDLNVTVDYASGDELGMLAGDMNRMVEKL 265
Cdd:PRK10549 174 TLLAALATFLLArgllAPVKRLVEGTHKLAAGDFTTRVTPTSRDELGRLAQDFNQLASTL 233
VicK COG5002
Signal transduction histidine kinase [Signal transduction mechanisms];
177-297 1.39e-03

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 227335  Cd Length: 459  Bit Score: 41.26  E-value: 1.39e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39996137 177 VIGVDVSTADVNAVLRSS------LITTVVMGAVLFVagtLLMLLVIRPVSAAVRMLAEKVNHVADGDLNVTVDYASGDE 250
Cdd:COG5002   8 VIGAIYIEASIEDVYNQMnfinniLISGTLIALIITA---LLGILLARTITKPITDMRKQAVDMARGNYSRKVKVYGTDE 84
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 39996137 251 LGMLAGDMNRMVEKLRDMVAGVAGAAaevttaaRQLSSTSEEMAAGV 297
Cdd:COG5002  85 IGELADSFNDLTKRVQEAQANTEQER-------RKLDSVLAYMTDGV 124
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH