NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|37523587|ref|NP_926964|]
View 

serine/threonine kinase [Gloeobacter violaceus PCC 7421]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PKc_like super family cl21453
Protein Kinases, catalytic domain; The protein kinase superfamily is mainly composed of the ...
1-80 1.89e-11

Protein Kinases, catalytic domain; The protein kinase superfamily is mainly composed of the catalytic domains of serine/threonine-specific and tyrosine-specific protein kinases. It also includes RIO kinases, which are atypical serine protein kinases, aminoglycoside phosphotransferases, and choline kinases. These proteins catalyze the transfer of the gamma-phosphoryl group from ATP to hydroxyl groups in specific substrates such as serine, threonine, or tyrosine residues of proteins.


The actual alignment was detected with superfamily member cd14014:

Pssm-ID: 328722  Cd Length: 260  Bit Score: 62.22  E-value: 1.89e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523587   1 MPPEQFEGRTV-PASDLFGLGATLLFLLTGINP--GELPRENFRIRLGERA----------SAGLKPWLERMLDPDLQYR 67
Cdd:cd14014 168 MAPEQARGGPVdPRSDIYSLGVVLYELLTGRPPfdGDSPAAVLAKHLQEAPpppsplnpdvPPALDAIILRALAKDPEER 247
                        90
                ....*....|...
gi 37523587  68 FASACAAHEALDR 80
Cdd:cd14014 248 PQSAAELLAALRA 260
 
Name Accession Description Interval E-value
STKc_PknB_like cd14014
Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs ...
1-80 1.89e-11

Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


Pssm-ID: 270916  Cd Length: 260  Bit Score: 62.22  E-value: 1.89e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523587   1 MPPEQFEGRTV-PASDLFGLGATLLFLLTGINP--GELPRENFRIRLGERA----------SAGLKPWLERMLDPDLQYR 67
Cdd:cd14014 168 MAPEQARGGPVdPRSDIYSLGVVLYELLTGRPPfdGDSPAAVLAKHLQEAPpppsplnpdvPPALDAIILRALAKDPEER 247
                        90
                ....*....|...
gi 37523587  68 FASACAAHEALDR 80
Cdd:cd14014 248 PQSAAELLAALRA 260
SPS1 COG0515
Serine/threonine protein kinase [Signal transduction mechanisms];
1-103 1.09e-03

Serine/threonine protein kinase [Signal transduction mechanisms];


Pssm-ID: 223589  Cd Length: 384  Bit Score: 39.73  E-value: 1.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523587   1 MPPEQFEG----RTVPASDLFGLGATLLFLLTGINPGELPRENF---------------------RIRLGERASAGLKPW 55
Cdd:COG0515 175 MAPEVLLGlslaYASSSSDIWSLGITLYELLTGLPPFEGEKNSSatsqtlkiilelptpslasplSPSNPELISKAASDL 254
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
gi 37523587  56 LERMLDPDLQYRF-ASACAAHEALDRQENRPVPTVSGQPTGSCIALKRT 103
Cdd:COG0515 255 LKKLLAKDPKNRLsSSSDLSHDLLAHLKLKESDLSDLLKPDDSAPLRLS 303
 
Name Accession Description Interval E-value
STKc_PknB_like cd14014
Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs ...
1-80 1.89e-11

Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


Pssm-ID: 270916  Cd Length: 260  Bit Score: 62.22  E-value: 1.89e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523587   1 MPPEQFEGRTV-PASDLFGLGATLLFLLTGINP--GELPRENFRIRLGERA----------SAGLKPWLERMLDPDLQYR 67
Cdd:cd14014 168 MAPEQARGGPVdPRSDIYSLGVVLYELLTGRPPfdGDSPAAVLAKHLQEAPpppsplnpdvPPALDAIILRALAKDPEER 247
                        90
                ....*....|...
gi 37523587  68 FASACAAHEALDR 80
Cdd:cd14014 248 PQSAAELLAALRA 260
STKc_IRAK cd14066
Catalytic domain of the Serine/Threonine kinases, Interleukin-1 Receptor Associated Kinases ...
1-80 3.61e-04

Catalytic domain of the Serine/Threonine kinases, Interleukin-1 Receptor Associated Kinases and related STKs; STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. IRAKs are involved in Toll-like receptor (TLR) and interleukin-1 (IL-1) signalling pathways, and are thus critical in regulating innate immune responses and inflammation. Some IRAKs may also play roles in T- and B-cell signaling, and adaptive immunity. Vertebrates contain four IRAKs (IRAK-1, -2, -3 (or -M), and -4) that display distinct functions and patterns of expression and subcellular distribution, and can differentially mediate TLR signaling. IRAK-1, -2, and -4 are ubiquitously expressed and are active kinases, while IRAK-M is only induced in monocytes and macrophages and is an inactive kinase. Variations in IRAK genes are linked to diverse diseases including infection, sepsis, cancer, and autoimmune diseases. IRAKs contain an N-terminal Death domain (DD), a proST region (rich in serines, prolines, and threonines), a central kinase domain (a pseudokinase domain in the case of IRAK3), and a C-terminal domain; IRAK-4 lacks the C-terminal domain. This subfamily includes plant receptor-like kinases (RLKs) including Arabidopsis thaliana BAK1 and CLAVATA1 (CLV1). BAK1 functions in BR (brassinosteroid)-regulated plant development and in pathways involved in plant resistance to pathogen infection and herbivore attack. CLV1, directly binds small signaling peptides, CLAVATA3 (CLV3) and CLAVATA3/EMBRYO SURROUNDING REGI0N (CLE), to restrict stem cell proliferation: the CLV3-CLV1-WUS (WUSCHEL) module influences stem cell maintenance in the shoot apical meristem, and the CLE40 (CLAVATA3/EMBRYO SURROUNDING REGION40) -ACR4 (CRINKLY4) -CLV1- WOX5 (WUSCHEL-RELATED HOMEOBOX5) module at the root apical meristem. The IRAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


Pssm-ID: 270968  Cd Length: 272  Bit Score: 40.72  E-value: 3.61e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523587   1 MPPEQFEGRTV-PASDLFGLGATLLFLLTGINPGELPRENF-RIRLGERASAGLKPWLERMLDPDLQ------------- 65
Cdd:cd14066 165 LAPEYIRTGRVsTKSDVYSFGVVLLELLTGKPAVDENRENAsRKDLVEWVESKGKEELEDILDKRLVdddgveeeeveal 244
                        90
                ....*....|....*
gi 37523587  66 YRFASACAAHEALDR 80
Cdd:cd14066 245 LRLALLCTRSDPSLR 259
SPS1 COG0515
Serine/threonine protein kinase [Signal transduction mechanisms];
1-103 1.09e-03

Serine/threonine protein kinase [Signal transduction mechanisms];


Pssm-ID: 223589  Cd Length: 384  Bit Score: 39.73  E-value: 1.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523587   1 MPPEQFEG----RTVPASDLFGLGATLLFLLTGINPGELPRENF---------------------RIRLGERASAGLKPW 55
Cdd:COG0515 175 MAPEVLLGlslaYASSSSDIWSLGITLYELLTGLPPFEGEKNSSatsqtlkiilelptpslasplSPSNPELISKAASDL 254
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
gi 37523587  56 LERMLDPDLQYRF-ASACAAHEALDRQENRPVPTVSGQPTGSCIALKRT 103
Cdd:COG0515 255 LKKLLAKDPKNRLsSSSDLSHDLLAHLKLKESDLSDLLKPDDSAPLRLS 303
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH