NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|37522761|ref|NP_926138|]
View 

hypothetical protein gll3192 [Gloeobacter violaceus PCC 7421]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DICT super family cl01731
Sensory domain in DIguanylate Cyclases and Two-component system; DICT is a sensory domain ...
2-224 2.16e-51

Sensory domain in DIguanylate Cyclases and Two-component system; DICT is a sensory domain found associated with GGDEF, EAL, HD-GYP, STAS, and two component systems (histidine-kinase type). It assumes an alpha+beta fold with a 4-stranded beta-sheet and might have a role in light response (Natural history of sensor domains in bacterial signaling systems by Aravind L, LM Iyer, Anantharaman V, from 'Sensory Mechanisms in Bacteria: Molecular Aspects of Signal Recognition.' Caister Academic Press. 2010) - see (http://de.scribd.com/doc/28576661/Bacterial-Signaling-Chapter)


The actual alignment was detected with superfamily member COG4250:

Pssm-ID: 321635  Cd Length: 226  Bit Score: 175.90  E-value: 2.16e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761   2 MLEG-SILYKLRKQL--GADPPSFGVYYKNTLVALCHALEDHILT-CGSPPLVLTAFQRGKWYAQEAKRYRQLAMHSRQV 77
Cdd:COG4250   1 MSESrSVLKALLQSLpyGDVVLRVQEYFKSSLVALSHAMEDQVLAvTADAPLVIAAFQRERFYRQEAHRYHRIADESSQI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761  78 LIMAVPDSGFLQ-PDNPANLTQLALSETDPVSVEWHLMILAPNYAAMVMCQELGEAEygpggRPQQDVERKFYGFWTFEE 156
Cdd:COG4250  81 YVLSAPETTFASyDRSQMTYESVAFEPRDWLAQEWHLIVGFDRYANCLKCRETYEQL-----RPACDLSRRFYGVWTFER 155
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 37522761 157 PLVRAAVDLTLDHIRGYDAKLTEKLE---NELERIDAEPAGSRSDLSGVVARVVTYLQSSQQQLVSLTRPA 224
Cdd:COG4250 156 GVSSFAAQLLLSRILAYRPELAKKDGgadQAQSSALVAEERADGGTDPFVQRLVTYLQAGQEALAGYRQPA 226
DUF3391 super family cl26425
Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain ...
262-414 8.34e-18

Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 122 to 139 amino acids in length. This domain is found associated with pfam01966.


The actual alignment was detected with superfamily member COG2206:

Pssm-ID: 331246  Cd Length: 344  Bit Score: 84.08  E-value: 8.34e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761 262 QASLQVSSLVEVIGQLMNLPFGRLRRLRLAALLHRVGLSEIPGTLIDPDSPDTLKVLAEA---AGFAGELLRSMPEL-RS 337
Cdd:COG2206 151 GHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIkkhPIYGYDILKDLPEFlES 230
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 37522761 338 VARIVERQYEWWNGEGLPEGLAGEAIPLEARILGLAAYFQEWLVARGERPVCTPSEALSLCETGAGGRWDPQLLEQL 414
Cdd:COG2206 231 VRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYKKAKSPEEALEELRKNSGGKFDPKVVDAF 307
 
Name Accession Description Interval E-value
DICT COG4250
Sensory domain found in diguanylate cyclases and two-component systems (DICT domain) [Signal ...
2-224 2.16e-51

Sensory domain found in diguanylate cyclases and two-component systems (DICT domain) [Signal transduction mechanisms];


Pssm-ID: 226701  Cd Length: 226  Bit Score: 175.90  E-value: 2.16e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761   2 MLEG-SILYKLRKQL--GADPPSFGVYYKNTLVALCHALEDHILT-CGSPPLVLTAFQRGKWYAQEAKRYRQLAMHSRQV 77
Cdd:COG4250   1 MSESrSVLKALLQSLpyGDVVLRVQEYFKSSLVALSHAMEDQVLAvTADAPLVIAAFQRERFYRQEAHRYHRIADESSQI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761  78 LIMAVPDSGFLQ-PDNPANLTQLALSETDPVSVEWHLMILAPNYAAMVMCQELGEAEygpggRPQQDVERKFYGFWTFEE 156
Cdd:COG4250  81 YVLSAPETTFASyDRSQMTYESVAFEPRDWLAQEWHLIVGFDRYANCLKCRETYEQL-----RPACDLSRRFYGVWTFER 155
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 37522761 157 PLVRAAVDLTLDHIRGYDAKLTEKLE---NELERIDAEPAGSRSDLSGVVARVVTYLQSSQQQLVSLTRPA 224
Cdd:COG4250 156 GVSSFAAQLLLSRILAYRPELAKKDGgadQAQSSALVAEERADGGTDPFVQRLVTYLQAGQEALAGYRQPA 226
DICT pfam10069
Sensory domain in DIguanylate Cyclases and Two-component system; DICT is a sensory domain ...
5-127 8.36e-47

Sensory domain in DIguanylate Cyclases and Two-component system; DICT is a sensory domain found associated with GGDEF, EAL, HD-GYP, STAS, and two component systems (histidine-kinase type). It assumes an alpha+beta fold with a 4-stranded beta-sheet and might have a role in light response (Natural history of sensor domains in bacterial signaling systems by Aravind L, LM Iyer, Anantharaman V, from 'Sensory Mechanisms in Bacteria: Molecular Aspects of Signal Recognition.' Caister Academic Press. 2010) - see (http://de.scribd.com/doc/28576661/Bacterial-Signaling-Chapter)


Pssm-ID: 313319  Cd Length: 123  Bit Score: 160.08  E-value: 8.36e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761     5 GSILYKLRKQLG-ADPPSFGVYYKNTLVALCHALEDHILTCGSPPLVLTAFQRGKWYAQEAKRYRQLAMHSRQVLIMAVP 83
Cdd:pfam10069   1 ESSLYQLLQALPtLPPPSPLVYSKATLTALSRALEDLLLEQQIPATVWAKFQRGKFYRQEADRYQRLAQKSRQVYVCAAP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 37522761    84 DSGFlqPDNPANLTQLAL-SETDPVSVEWHLMILAPNYAAMVMCQ 127
Cdd:pfam10069  81 DTEF--AESLPNVETVALdPNSDPLRREWFLIVLSPQFCSCLLAQ 123
HDGYP COG2206
HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal ...
262-414 8.34e-18

HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal transduction mechanisms];


Pssm-ID: 225116  Cd Length: 344  Bit Score: 84.08  E-value: 8.34e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761 262 QASLQVSSLVEVIGQLMNLPFGRLRRLRLAALLHRVGLSEIPGTLIDPDSPDTLKVLAEA---AGFAGELLRSMPEL-RS 337
Cdd:COG2206 151 GHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIkkhPIYGYDILKDLPEFlES 230
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 37522761 338 VARIVERQYEWWNGEGLPEGLAGEAIPLEARILGLAAYFQEWLVARGERPVCTPSEALSLCETGAGGRWDPQLLEQL 414
Cdd:COG2206 231 VRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYKKAKSPEEALEELRKNSGGKFDPKVVDAF 307
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
327-370 2.56e-11

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 316047  Cd Length: 64  Bit Score: 60.29  E-value: 2.56e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 37522761   327 ELLRSMPELRS-VARIVERQYEWWNGEGLPEGLAGEAIPLEARIL 370
Cdd:pfam13487  20 RLLSKLPRLPDeVAEIIGQHHERLDGSGYPRGLKGEEIPLGARIL 64
 
Name Accession Description Interval E-value
DICT COG4250
Sensory domain found in diguanylate cyclases and two-component systems (DICT domain) [Signal ...
2-224 2.16e-51

Sensory domain found in diguanylate cyclases and two-component systems (DICT domain) [Signal transduction mechanisms];


Pssm-ID: 226701  Cd Length: 226  Bit Score: 175.90  E-value: 2.16e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761   2 MLEG-SILYKLRKQL--GADPPSFGVYYKNTLVALCHALEDHILT-CGSPPLVLTAFQRGKWYAQEAKRYRQLAMHSRQV 77
Cdd:COG4250   1 MSESrSVLKALLQSLpyGDVVLRVQEYFKSSLVALSHAMEDQVLAvTADAPLVIAAFQRERFYRQEAHRYHRIADESSQI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761  78 LIMAVPDSGFLQ-PDNPANLTQLALSETDPVSVEWHLMILAPNYAAMVMCQELGEAEygpggRPQQDVERKFYGFWTFEE 156
Cdd:COG4250  81 YVLSAPETTFASyDRSQMTYESVAFEPRDWLAQEWHLIVGFDRYANCLKCRETYEQL-----RPACDLSRRFYGVWTFER 155
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 37522761 157 PLVRAAVDLTLDHIRGYDAKLTEKLE---NELERIDAEPAGSRSDLSGVVARVVTYLQSSQQQLVSLTRPA 224
Cdd:COG4250 156 GVSSFAAQLLLSRILAYRPELAKKDGgadQAQSSALVAEERADGGTDPFVQRLVTYLQAGQEALAGYRQPA 226
DICT pfam10069
Sensory domain in DIguanylate Cyclases and Two-component system; DICT is a sensory domain ...
5-127 8.36e-47

Sensory domain in DIguanylate Cyclases and Two-component system; DICT is a sensory domain found associated with GGDEF, EAL, HD-GYP, STAS, and two component systems (histidine-kinase type). It assumes an alpha+beta fold with a 4-stranded beta-sheet and might have a role in light response (Natural history of sensor domains in bacterial signaling systems by Aravind L, LM Iyer, Anantharaman V, from 'Sensory Mechanisms in Bacteria: Molecular Aspects of Signal Recognition.' Caister Academic Press. 2010) - see (http://de.scribd.com/doc/28576661/Bacterial-Signaling-Chapter)


Pssm-ID: 313319  Cd Length: 123  Bit Score: 160.08  E-value: 8.36e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761     5 GSILYKLRKQLG-ADPPSFGVYYKNTLVALCHALEDHILTCGSPPLVLTAFQRGKWYAQEAKRYRQLAMHSRQVLIMAVP 83
Cdd:pfam10069   1 ESSLYQLLQALPtLPPPSPLVYSKATLTALSRALEDLLLEQQIPATVWAKFQRGKFYRQEADRYQRLAQKSRQVYVCAAP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 37522761    84 DSGFlqPDNPANLTQLAL-SETDPVSVEWHLMILAPNYAAMVMCQ 127
Cdd:pfam10069  81 DTEF--AESLPNVETVALdPNSDPLRREWFLIVLSPQFCSCLLAQ 123
CHASE6_C pfam17150
C-terminal domain of two-partite extracellular sensor domain; CHASE6 was originally described ...
143-218 1.60e-29

C-terminal domain of two-partite extracellular sensor domain; CHASE6 was originally described as a two-partite extracellular (periplasmic) sensor domain found in histidine kinases and HD-GYP-type c-di-GMP-specific phosphodiesterases and assigned to COG4250 in the COG database. Subsequently, its N-terminal part has been described as a separate DICT (DIguanylate Cyclases and Two-component systems) domain (PF10069) (Aravind L., Iyer LM, Anantharaman V. (2010) Natural history of sensor domains in the bacterial signalling systems. In: Sensory Mechanisms in Bacteria: Molecular Aspects of Signal Recognition ((Spiro S, Dixon R, eds)), pp. 1-38. Caister Academic Press, Norfolk, UK). The current entry contains only the C-terminal part of the original CHASE6 domain described in, which is found primarily in cyanobacteria.


Pssm-ID: 319168  Cd Length: 80  Bit Score: 111.08  E-value: 1.60e-29
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 37522761   143 DVERKFYGFWTFEEPLVRAAVDLTLDHIRGYDAKLTEKLENELERIDAEPA--GSRSDLSGVVARVVTYLQSSQQQLV 218
Cdd:pfam17150   2 DTERKFEGIWTFDRQLVEKAAELLLARILSYRPELAEKLEQAKQRIAATPAetSPPIDPDPFVQRLVTYLQASQYKLL 79
HDGYP COG2206
HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal ...
262-414 8.34e-18

HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal transduction mechanisms];


Pssm-ID: 225116  Cd Length: 344  Bit Score: 84.08  E-value: 8.34e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761 262 QASLQVSSLVEVIGQLMNLPFGRLRRLRLAALLHRVGLSEIPGTLIDPDSPDTLKVLAEA---AGFAGELLRSMPEL-RS 337
Cdd:COG2206 151 GHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIkkhPIYGYDILKDLPEFlES 230
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 37522761 338 VARIVERQYEWWNGEGLPEGLAGEAIPLEARILGLAAYFQEWLVARGERPVCTPSEALSLCETGAGGRWDPQLLEQL 414
Cdd:COG2206 231 VRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYKKAKSPEEALEELRKNSGGKFDPKVVDAF 307
RpfG COG3437
Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains ...
303-416 4.30e-13

Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains [Signal transduction mechanisms];


Pssm-ID: 225971  Cd Length: 360  Bit Score: 70.08  E-value: 4.30e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37522761 303 PGTLiDPDSPDTLKVLAEaagFAGELL-RSMPELRSVARIVERQYEWWNGEGLPEGLAGEAIPLEARILGLAAYFQEWLV 381
Cdd:COG3437 236 PGKL-TSEEFEIMKGHPI---LGAEILkSSERLMQVAAEIARHHHERWDGSGYPDGLKGDEIPLSARIVAIADVFDALVS 311
                        90       100       110
                ....*....|....*....|....*....|....*
gi 37522761 382 ARGERPVCTPSEALSLCETGAGGRWDPQLLEQLAN 416
Cdd:COG3437 312 GRPYKEAMSTEEALEIIRAQSGRLFDPKLVEAFIQ 346
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
327-370 2.56e-11

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 316047  Cd Length: 64  Bit Score: 60.29  E-value: 2.56e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 37522761   327 ELLRSMPELRS-VARIVERQYEWWNGEGLPEGLAGEAIPLEARIL 370
Cdd:pfam13487  20 RLLSKLPRLPDeVAEIIGQHHERLDGSGYPRGLKGEEIPLGARIL 64
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH