NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|352962176|ref|NP_001238759|]
View 

osteopontin isoform 5 [Homo sapiens]

Protein Classification

Osteopontin domain-containing protein (domain architecture ID 10467645)

Osteopontin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Osteopontin pfam00865
Osteopontin;
43-327 1.43e-143

Osteopontin;


:

Pssm-ID: 307146  Cd Length: 291  Bit Score: 411.18  E-value: 1.43e-143
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176   43 KELYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSD 122
Cdd:pfam00865  10 KQLYNKHPDAVATWLKPDPSQKQNLLAPQNAVSSEETDDFKQETLPSKSNESHDHMDDVDDDDDGDHVDSQDSVDSDDAD 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176  123 DVDDTddsHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDI 202
Cdd:pfam00865  90 DTDDS---HHSDESHHSDESDELVTDFPTDIPATPVFTPAVPTVDTYDGRGDSVAYGLRSKSKKFHKSEVQYPDATEEDL 166
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176  203 TSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKV 282
Cdd:pfam00865 167 TSHMESEESDDAHKAIPVAQRLNVPSDWDSNGKDSHETSQLDDHSVETHSHEQSKEYKLKANDESSEHSDVIDSQENSKV 246
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 352962176  283 SREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN 327
Cdd:pfam00865 247 SQEFHSQEFHSHEDKLVLDPKSEEEDKHLKFRVSHELDSASSEVN 291
 
Name Accession Description Interval E-value
Osteopontin pfam00865
Osteopontin;
43-327 1.43e-143

Osteopontin;


Pssm-ID: 307146  Cd Length: 291  Bit Score: 411.18  E-value: 1.43e-143
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176   43 KELYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSD 122
Cdd:pfam00865  10 KQLYNKHPDAVATWLKPDPSQKQNLLAPQNAVSSEETDDFKQETLPSKSNESHDHMDDVDDDDDGDHVDSQDSVDSDDAD 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176  123 DVDDTddsHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDI 202
Cdd:pfam00865  90 DTDDS---HHSDESHHSDESDELVTDFPTDIPATPVFTPAVPTVDTYDGRGDSVAYGLRSKSKKFHKSEVQYPDATEEDL 166
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176  203 TSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKV 282
Cdd:pfam00865 167 TSHMESEESDDAHKAIPVAQRLNVPSDWDSNGKDSHETSQLDDHSVETHSHEQSKEYKLKANDESSEHSDVIDSQENSKV 246
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 352962176  283 SREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN 327
Cdd:pfam00865 247 SQEFHSQEFHSHEDKLVLDPKSEEEDKHLKFRVSHELDSASSEVN 291
OSTEO smart00017
Osteopontin; Osteopontin is an acidic phosphorylated glycoprotein of about 40 Kd which is ...
43-327 1.09e-112

Osteopontin; Osteopontin is an acidic phosphorylated glycoprotein of about 40 Kd which is abundant in the mineral matrix of bones and which binds tightly to hydroxyapatite. It is suggested that osteopontin might function as a cell attachment factor and could play a key role in the adhesion of osteoclasts to the mineral matrix of bone


Pssm-ID: 214472  Cd Length: 287  Bit Score: 332.34  E-value: 1.09e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176    43 KELYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSD 122
Cdd:smart00017  14 KQLYNKHPDAVATWLKPDPSQKQNLLAPQNAVSSEETDDFKQETLPSKSNESHEHTDDLDDDDDDDHVDDRDNDSDDAED 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176   123 DVDDtddsHQSDESHHSDESDelVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDI 202
Cdd:smart00017  94 SDDS----DESDESHHSDESD--VTDFPTDAPATDVFTPFVPTVDTNDGRGDSVAYGLRSKSKKFRVSNLQYPDATEEDL 167
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176   203 TSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDeSNEHSDVIDSQELSKV 282
Cdd:smart00017 168 TSHVESEELDDAPKAIPVAQRLNVPSDWDSAGKDSHKTSQLDDHSVETHSHEQSKEYKRKAFD-SNEHSDVIDSQESSKV 246
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*
gi 352962176   283 SrefhSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN 327
Cdd:smart00017 247 S----SREFHSHEDKLDLDPKSEEDDKHLKFRISHELDSASSEVN 287
 
Name Accession Description Interval E-value
Osteopontin pfam00865
Osteopontin;
43-327 1.43e-143

Osteopontin;


Pssm-ID: 307146  Cd Length: 291  Bit Score: 411.18  E-value: 1.43e-143
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176   43 KELYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSD 122
Cdd:pfam00865  10 KQLYNKHPDAVATWLKPDPSQKQNLLAPQNAVSSEETDDFKQETLPSKSNESHDHMDDVDDDDDGDHVDSQDSVDSDDAD 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176  123 DVDDTddsHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDI 202
Cdd:pfam00865  90 DTDDS---HHSDESHHSDESDELVTDFPTDIPATPVFTPAVPTVDTYDGRGDSVAYGLRSKSKKFHKSEVQYPDATEEDL 166
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176  203 TSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKV 282
Cdd:pfam00865 167 TSHMESEESDDAHKAIPVAQRLNVPSDWDSNGKDSHETSQLDDHSVETHSHEQSKEYKLKANDESSEHSDVIDSQENSKV 246
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 352962176  283 SREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN 327
Cdd:pfam00865 247 SQEFHSQEFHSHEDKLVLDPKSEEEDKHLKFRVSHELDSASSEVN 291
OSTEO smart00017
Osteopontin; Osteopontin is an acidic phosphorylated glycoprotein of about 40 Kd which is ...
43-327 1.09e-112

Osteopontin; Osteopontin is an acidic phosphorylated glycoprotein of about 40 Kd which is abundant in the mineral matrix of bones and which binds tightly to hydroxyapatite. It is suggested that osteopontin might function as a cell attachment factor and could play a key role in the adhesion of osteoclasts to the mineral matrix of bone


Pssm-ID: 214472  Cd Length: 287  Bit Score: 332.34  E-value: 1.09e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176    43 KELYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSD 122
Cdd:smart00017  14 KQLYNKHPDAVATWLKPDPSQKQNLLAPQNAVSSEETDDFKQETLPSKSNESHEHTDDLDDDDDDDHVDDRDNDSDDAED 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176   123 DVDDtddsHQSDESHHSDESDelVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDI 202
Cdd:smart00017  94 SDDS----DESDESHHSDESD--VTDFPTDAPATDVFTPFVPTVDTNDGRGDSVAYGLRSKSKKFRVSNLQYPDATEEDL 167
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 352962176   203 TSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDeSNEHSDVIDSQELSKV 282
Cdd:smart00017 168 TSHVESEELDDAPKAIPVAQRLNVPSDWDSAGKDSHKTSQLDDHSVETHSHEQSKEYKRKAFD-SNEHSDVIDSQESSKV 246
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*
gi 352962176   283 SrefhSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN 327
Cdd:smart00017 247 S----SREFHSHEDKLDLDPKSEEDDKHLKFRISHELDSASSEVN 287
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH