NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|345792331|ref|XP_852839|]
View 

solute carrier organic anion transporter family member 1A2 isoform X1 [Canis lupus familiaris]

Protein Classification

oat family protein (domain architecture ID 11489679)

oat family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


:

Pssm-ID: 273279  Cd Length: 632  Bit Score: 934.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331    1 MAEIEKRLETH--------RMRCL----SKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIG 68
Cdd:TIGR00805   1 MGETEKDIATHessaglkpRPRCLqslfSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331   69 NLLLIIFVSYFGTKLHRPILIGVGCVVMGLGCFLQSLPHFLMGRYEYESTVSVSGNLSS-NSFLCMENGTQTFRPTEDPS 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSaNSFLCMENLTQTLRPTQDPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  148 ECVKEVKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGFVETGAIIGPLIGLLLASFCANVYVDTGSV 227
Cdd:TIGR00805 161 ECQKQHKSLMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  228 NTDDLTITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPKTLPKEGLKNNADIIKNDKEEKQREAVKKEKDGITKDFLP 307
Cdd:TIGR00805 241 NTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKEGKRVNVDVHEAEKLEKSRGEDRKKNSGITKDFPK 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  308 FMKSLLCNPIYMLFILISIVQFNAFVNMFTFMPKYLEQQYGKSASEAIFLIGIYNLPPICIGYIAGGLIMKKFKITVKQA 387
Cdd:TIGR00805 321 FIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKA 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  388 AHIGCWLSLIEYLLHFLCFLMICDNTSVAGITTtyKGIQQDLYVENTIlaDCNKDCNCPIKMWDPVCGNNGVSYMSACLA 467
Cdd:TIGR00805 401 AYFAICLSTLEYLLYSPKFLITCESAPVAGVNN--PSNDQPLYVENRT--DCNRQCSCDSSIWDPVCGDNGLAYLSPCHA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  468 GCETSVGTGINMVFQNCSCIQTSGNSSAVLGLCDKgyDCSMMLQYFLILSAIGSFIYSLSAIPGYMVLLRCIKPEEKSLG 547
Cdd:TIGR00805 477 GCRMSVGTGSNMVFTNCSCIQTPGNSSAKKGLCDP--PCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 345792331  548 VGLHTFCTRVFAGIPAPIYFGALVDSTCLHWGMLKCGESGACRIYDSTNFRYIYLGLPAALRGTSYIPAFLILIMLKK 625
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
 
Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279  Cd Length: 632  Bit Score: 934.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331    1 MAEIEKRLETH--------RMRCL----SKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIG 68
Cdd:TIGR00805   1 MGETEKDIATHessaglkpRPRCLqslfSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331   69 NLLLIIFVSYFGTKLHRPILIGVGCVVMGLGCFLQSLPHFLMGRYEYESTVSVSGNLSS-NSFLCMENGTQTFRPTEDPS 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSaNSFLCMENLTQTLRPTQDPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  148 ECVKEVKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGFVETGAIIGPLIGLLLASFCANVYVDTGSV 227
Cdd:TIGR00805 161 ECQKQHKSLMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  228 NTDDLTITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPKTLPKEGLKNNADIIKNDKEEKQREAVKKEKDGITKDFLP 307
Cdd:TIGR00805 241 NTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKEGKRVNVDVHEAEKLEKSRGEDRKKNSGITKDFPK 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  308 FMKSLLCNPIYMLFILISIVQFNAFVNMFTFMPKYLEQQYGKSASEAIFLIGIYNLPPICIGYIAGGLIMKKFKITVKQA 387
Cdd:TIGR00805 321 FIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKA 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  388 AHIGCWLSLIEYLLHFLCFLMICDNTSVAGITTtyKGIQQDLYVENTIlaDCNKDCNCPIKMWDPVCGNNGVSYMSACLA 467
Cdd:TIGR00805 401 AYFAICLSTLEYLLYSPKFLITCESAPVAGVNN--PSNDQPLYVENRT--DCNRQCSCDSSIWDPVCGDNGLAYLSPCHA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  468 GCETSVGTGINMVFQNCSCIQTSGNSSAVLGLCDKgyDCSMMLQYFLILSAIGSFIYSLSAIPGYMVLLRCIKPEEKSLG 547
Cdd:TIGR00805 477 GCRMSVGTGSNMVFTNCSCIQTPGNSSAKKGLCDP--PCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 345792331  548 VGLHTFCTRVFAGIPAPIYFGALVDSTCLHWGMLKCGESGACRIYDSTNFRYIYLGLPAALRGTSYIPAFLILIMLKK 625
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
21-597 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 308646  Cd Length: 526  Bit Score: 647.31  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331   21 MFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPILIGVGCVVMGLGC 100
Cdd:pfam03137   1 GFLVFLCLLGLLQAMVSGYFNSSITTIEKRFGLPSSTSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGIGALLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  101 FLQSLPHFlmgryeyestvsvsgnlssnsflcmengtqtfrptedpsecvkevkslmwIYVLVGNIIRGIGETPIMPLGI 180
Cdd:pfam03137  81 LLFALPHF--------------------------------------------------LSFFLGQLLLGIGATPIYTLGI 110
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  181 SYIEDFAKSENSPLYIGFVETGAIIGPLIGLLLASFCANVYVDTGSvntdDLTITPTDTRWVGAWWFGFLICAGVNVLTA 260
Cdd:pfam03137 111 SYIDDNVKKKNSPLYIGILYAVRMLGPALGFLLGSLCLRLYVDPGS----SITLTPKDPRWVGAWWLGFLIAGVLLLLTA 186
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  261 IPFFFLPKTLPKEG-LKNNADIIKNDKEEKQREAVKKEKDGIT-KDFLPFMKSLLCNPIYMLFILISIVQFNAFVNMFTF 338
Cdd:pfam03137 187 IPFFFFPKSLPGAKkLRAERRKEPHKEEKKDKEKGTSIKLGKSlKDFPKALKRLLKNPVYMLLTLASVFESLGIAGFATF 266
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  339 MPKYLEQQYGKSASEAIFLIGIYNLPPICIGYIAGGLIMKKFKITVKQAAHIGCWLSLIEYLLHFLCFLMICDNTSVAGI 418
Cdd:pfam03137 267 LPKYLETQFGLSASTANLLTGIVVIPGAALGILLGGLIIKKFKLSAKGAAKFNLVTSLLSLLLSLLLFFLGCDNSPVAGL 346
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  419 TTTYKGIQQDLyvENTILADCNKDCNCPIKMWDPVCGNNGV--SYMSACLAGCETSVGTGINMVFQNCSCIQTS----GN 492
Cdd:pfam03137 347 TVPYGGTGQLS--EGNLTASCNSDCSCSSSFYSPVCGSDGYgyTSPCPCGCGCSSSSGGGKNYYNCSCCCCCLSsgggGN 424
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  493 SSAVLGLCDKgyDCSMMLQYFLILSAIGSFIYSLSAIPGYMVLLRCIKPEEKSLGVGLHTFCTRVFAGIPAPIYFGALVD 572
Cdd:pfam03137 425 GSAVPGKCPS--DCSNKLPLFLALLFLLSFFGALSSTPSTLIILRCVPPEDKSFALGLQFLILRLLGFIPGPIIFGALID 502
                         570       580
                  ....*....|....*....|....*
gi 345792331  573 STCLHWGMlKCGESGACRIYDSTNF 597
Cdd:pfam03137 503 STCLLWTK-TCGGRGACWLYDNDKF 526
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
435-488 1.45e-21

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650  Cd Length: 54  Bit Score: 90.44  E-value: 1.45e-21
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 345792331 435 ILADCNKDCNCPIKMWDPVCGNNGVSYMSACLAGCETSVGTGINMVFQNCSCIQ 488
Cdd:cd01330    1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCVG 54
UhpC COG2271
Sugar phosphate permease [Carbohydrate transport and metabolism];
243-376 7.20e-03

Sugar phosphate permease [Carbohydrate transport and metabolism];


Pssm-ID: 225180  Cd Length: 448  Bit Score: 39.18  E-value: 7.20e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331 243 GAWWFGFLICAGVNVLTAIPFFFLPKTLPKE-GLkNNADIIKNDKEEKQREavKKEKDGITKdFLPFMKSLLCNPiYMLF 321
Cdd:COG2271  182 GGWRAAFYFPGIIAIIVALILLFLLRDRPQSeGL-PPIEEYRGDPLEIYEE--EKENEGLTA-WQIFVKYVLKNK-LIWL 256
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331 322 ILISivqfNAFVNMFTF-----MPKYLEQQYGKSASEAIFLIGIYNlppicIGYIAGGLI 376
Cdd:COG2271  257 LALA----NVFVYVVRYgindwGPLYLSEVKGFSLVKANWAISLFE-----VAGLPGTLL 307
 
Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279  Cd Length: 632  Bit Score: 934.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331    1 MAEIEKRLETH--------RMRCL----SKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIG 68
Cdd:TIGR00805   1 MGETEKDIATHessaglkpRPRCLqslfSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331   69 NLLLIIFVSYFGTKLHRPILIGVGCVVMGLGCFLQSLPHFLMGRYEYESTVSVSGNLSS-NSFLCMENGTQTFRPTEDPS 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSaNSFLCMENLTQTLRPTQDPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  148 ECVKEVKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGFVETGAIIGPLIGLLLASFCANVYVDTGSV 227
Cdd:TIGR00805 161 ECQKQHKSLMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  228 NTDDLTITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPKTLPKEGLKNNADIIKNDKEEKQREAVKKEKDGITKDFLP 307
Cdd:TIGR00805 241 NTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKEGKRVNVDVHEAEKLEKSRGEDRKKNSGITKDFPK 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  308 FMKSLLCNPIYMLFILISIVQFNAFVNMFTFMPKYLEQQYGKSASEAIFLIGIYNLPPICIGYIAGGLIMKKFKITVKQA 387
Cdd:TIGR00805 321 FIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKA 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  388 AHIGCWLSLIEYLLHFLCFLMICDNTSVAGITTtyKGIQQDLYVENTIlaDCNKDCNCPIKMWDPVCGNNGVSYMSACLA 467
Cdd:TIGR00805 401 AYFAICLSTLEYLLYSPKFLITCESAPVAGVNN--PSNDQPLYVENRT--DCNRQCSCDSSIWDPVCGDNGLAYLSPCHA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  468 GCETSVGTGINMVFQNCSCIQTSGNSSAVLGLCDKgyDCSMMLQYFLILSAIGSFIYSLSAIPGYMVLLRCIKPEEKSLG 547
Cdd:TIGR00805 477 GCRMSVGTGSNMVFTNCSCIQTPGNSSAKKGLCDP--PCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 345792331  548 VGLHTFCTRVFAGIPAPIYFGALVDSTCLHWGMLKCGESGACRIYDSTNFRYIYLGLPAALRGTSYIPAFLILIMLKK 625
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
21-597 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 308646  Cd Length: 526  Bit Score: 647.31  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331   21 MFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPILIGVGCVVMGLGC 100
Cdd:pfam03137   1 GFLVFLCLLGLLQAMVSGYFNSSITTIEKRFGLPSSTSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGIGALLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  101 FLQSLPHFlmgryeyestvsvsgnlssnsflcmengtqtfrptedpsecvkevkslmwIYVLVGNIIRGIGETPIMPLGI 180
Cdd:pfam03137  81 LLFALPHF--------------------------------------------------LSFFLGQLLLGIGATPIYTLGI 110
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  181 SYIEDFAKSENSPLYIGFVETGAIIGPLIGLLLASFCANVYVDTGSvntdDLTITPTDTRWVGAWWFGFLICAGVNVLTA 260
Cdd:pfam03137 111 SYIDDNVKKKNSPLYIGILYAVRMLGPALGFLLGSLCLRLYVDPGS----SITLTPKDPRWVGAWWLGFLIAGVLLLLTA 186
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  261 IPFFFLPKTLPKEG-LKNNADIIKNDKEEKQREAVKKEKDGIT-KDFLPFMKSLLCNPIYMLFILISIVQFNAFVNMFTF 338
Cdd:pfam03137 187 IPFFFFPKSLPGAKkLRAERRKEPHKEEKKDKEKGTSIKLGKSlKDFPKALKRLLKNPVYMLLTLASVFESLGIAGFATF 266
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  339 MPKYLEQQYGKSASEAIFLIGIYNLPPICIGYIAGGLIMKKFKITVKQAAHIGCWLSLIEYLLHFLCFLMICDNTSVAGI 418
Cdd:pfam03137 267 LPKYLETQFGLSASTANLLTGIVVIPGAALGILLGGLIIKKFKLSAKGAAKFNLVTSLLSLLLSLLLFFLGCDNSPVAGL 346
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  419 TTTYKGIQQDLyvENTILADCNKDCNCPIKMWDPVCGNNGV--SYMSACLAGCETSVGTGINMVFQNCSCIQTS----GN 492
Cdd:pfam03137 347 TVPYGGTGQLS--EGNLTASCNSDCSCSSSFYSPVCGSDGYgyTSPCPCGCGCSSSSGGGKNYYNCSCCCCCLSsgggGN 424
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  493 SSAVLGLCDKgyDCSMMLQYFLILSAIGSFIYSLSAIPGYMVLLRCIKPEEKSLGVGLHTFCTRVFAGIPAPIYFGALVD 572
Cdd:pfam03137 425 GSAVPGKCPS--DCSNKLPLFLALLFLLSFFGALSSTPSTLIILRCVPPEDKSFALGLQFLILRLLGFIPGPIIFGALID 502
                         570       580
                  ....*....|....*....|....*
gi 345792331  573 STCLHWGMlKCGESGACRIYDSTNF 597
Cdd:pfam03137 503 STCLLWTK-TCGGRGACWLYDNDKF 526
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
435-488 1.45e-21

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650  Cd Length: 54  Bit Score: 90.44  E-value: 1.45e-21
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 345792331 435 ILADCNKDCNCPIKMWDPVCGNNGVSYMSACLAGCETSVGTGINMVFQNCSCIQ 488
Cdd:cd01330    1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCVG 54
MFS_1 pfam07690
Major Facilitator Superfamily;
28-401 2.24e-13

Major Facilitator Superfamily;


Pssm-ID: 311564  Cd Length: 346  Bit Score: 71.69  E-value: 2.24e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331   28 CAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPILIGVGCVVMGLGCFLqslph 107
Cdd:pfam07690   4 AAFLAALGRSLLGPALPLYLAEDLGISPSEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLL----- 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  108 fLMgryeyestvsvsgnLSSNSFLcmengtqtfrptedpsecvkevkslmwiyVLVGNIIRGIGETPIMPLGISYIEDFA 187
Cdd:pfam07690  79 -LL--------------FASSLWL-----------------------------LLVLRVLQGLGAGALFPAAAALIADWF 114
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  188 KSENSPLYIGFVETGAIIGPLIGLLLASFCANVYvdtgsvntddltitptDTRWVgawwfgFLICAGVNVLTAIPFFFLP 267
Cdd:pfam07690 115 PPEERGRALGLLSAGFGLGAALGPLLGGLLASLF----------------GWRAA------FLILAILSLLAAVLAALLL 172
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  268 KTLPKEglknnadiikndkeekqrEAVKKEKDGITKDFLPFMKSLLCNPIYMLFILISIVQFNAFVnMFTFMPKYLEqQY 347
Cdd:pfam07690 173 PRPPPE------------------SKRPKPAEEAPAPLLPAWKLLLRDPVLWLLLALLLFGFAFFG-LLTYLPLYQE-VL 232
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 345792331  348 GKSASEAIFLIGIYNLPPICIGYIAGGLIMKKFKITVKQAAHIGCWLSLIEYLL 401
Cdd:pfam07690 233 GLSALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLLLALLLAILAALGLLL 286
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
23-381 1.16e-11

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392  Cd Length: 352  Bit Score: 66.57  E-value: 1.16e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331  23 LLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPILIGVGCVVMGLGCFL 102
Cdd:cd06174    1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331 103 QSLPHflmgryeyestvsvsgnlssnsflcmengtqtfrptedpsecvkevkslMWIYVLVGNIIRGIGETPIMPLGISY 182
Cdd:cd06174   81 LAFAS-------------------------------------------------SLWLLLVGRFLLGLGGGALYPAAAAL 111
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331 183 IEDFAKSENSPLYIGFVETGAIIGPLIGLLLASFCANVYvdtgsvntddltitptdtrwvgAWWFGFLICAGVNVLTAIP 262
Cdd:cd06174  112 IAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESL----------------------GWRWLFLILAILGLLLALL 169
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331 263 FFFLPKTLpkeglknnadiikndkeekqreavkkekdgitkdflpfmksllcnpiyMLFILISIVQFNAFVNMFTFMPKY 342
Cdd:cd06174  170 LLFLLRLL------------------------------------------------LLLALAFFLLSFGYYGLLTYLPLY 201
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 345792331 343 LEQQYGKSASEAIFLIGIYNLPPIcIGYIAGGLIMKKFK 381
Cdd:cd06174  202 LQEVLGLSAAEAGLLLSLFGLGGI-LGALLGGLLSDRLG 239
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
445-486 7.60e-11

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 311539  Cd Length: 42  Bit Score: 59.57  E-value: 7.60e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 345792331  445 CPIKMWDPVCGNNGVSYMSACLAGCETSVGTGINMVFQNCSC 486
Cdd:pfam07648   1 CPRENDEPVCGSDGKTYGNKCALCCANCLLGEKLKVKYEGSC 42
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
445-486 4.90e-07

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 48.42  E-value: 4.90e-07
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 345792331 445 CPiKMWDPVCGNNGVSYMSACLAGCETSVGTGINMVFQNCSC 486
Cdd:cd00104    1 CP-KEYDPVCGSDGKTYSNECHLGCAACRSGRSITVAHNGPC 41
UhpC COG2271
Sugar phosphate permease [Carbohydrate transport and metabolism];
243-376 7.20e-03

Sugar phosphate permease [Carbohydrate transport and metabolism];


Pssm-ID: 225180  Cd Length: 448  Bit Score: 39.18  E-value: 7.20e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331 243 GAWWFGFLICAGVNVLTAIPFFFLPKTLPKE-GLkNNADIIKNDKEEKQREavKKEKDGITKdFLPFMKSLLCNPiYMLF 321
Cdd:COG2271  182 GGWRAAFYFPGIIAIIVALILLFLLRDRPQSeGL-PPIEEYRGDPLEIYEE--EKENEGLTA-WQIFVKYVLKNK-LIWL 256
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 345792331 322 ILISivqfNAFVNMFTF-----MPKYLEQQYGKSASEAIFLIGIYNlppicIGYIAGGLI 376
Cdd:COG2271  257 LALA----NVFVYVVRYgindwGPLYLSEVKGFSLVKANWAISLFE-----VAGLPGTLL 307
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH