NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|343962599|ref|NP_001230635|]
View 

probable G-protein coupled receptor 82 [Sus scrofa]

Protein Classification

7tmA_GPR82 domain-containing protein (domain architecture ID 11606612)

7tmA_GPR82 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_GPR82 cd14996
orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G ...
16-318 1.54e-168

orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the G-protein coupled receptor 82 of unknown function. GPR82 is a member of the rhodopsin-like, class A GPCRs, which is a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


:

Pssm-ID: 320127  Cd Length: 305  Bit Score: 475.45  E-value: 1.54e-168
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLG 95
Cdd:cd14996    1 VALPIIYSFLFVTGVFGNLLSLWVFLTKISKKTSTHIYLINLVTANLLVCSAMPFQAAYFLKGFYWKYQSTQCRIANFFG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 TLSMHVSMFVSLLILSWIAISRYATLMKKDSTQETTSCYEKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd14996   81 TLVIHVSMCVSILILSWIAISRYATLMKHDSATQKQSCYEKIFYGHFLKRFRQPKFARYLCIYIWGVVLCIIIPVVVYYS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQ 255
Cdd:cd14996  161 VREADEDGESLCYNRQVELGAKGSQIAGLIATTFFFLFFLVVLLSYYSFVNHLRRIQKNTCISEKDLIYRSVKRNILIIQ 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 256 ILLVVCFLPYSIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14996  241 ALLVVCFLPYHIFKPVFYVLHQREDCQQLNYLIETKNILTCLASARSSTDPIMYLLLDKTFKK 303
 
Name Accession Description Interval E-value
7tmA_GPR82 cd14996
orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G ...
16-318 1.54e-168

orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the G-protein coupled receptor 82 of unknown function. GPR82 is a member of the rhodopsin-like, class A GPCRs, which is a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320127  Cd Length: 305  Bit Score: 475.45  E-value: 1.54e-168
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLG 95
Cdd:cd14996    1 VALPIIYSFLFVTGVFGNLLSLWVFLTKISKKTSTHIYLINLVTANLLVCSAMPFQAAYFLKGFYWKYQSTQCRIANFFG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 TLSMHVSMFVSLLILSWIAISRYATLMKKDSTQETTSCYEKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd14996   81 TLVIHVSMCVSILILSWIAISRYATLMKHDSATQKQSCYEKIFYGHFLKRFRQPKFARYLCIYIWGVVLCIIIPVVVYYS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQ 255
Cdd:cd14996  161 VREADEDGESLCYNRQVELGAKGSQIAGLIATTFFFLFFLVVLLSYYSFVNHLRRIQKNTCISEKDLIYRSVKRNILIIQ 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 256 ILLVVCFLPYSIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14996  241 ALLVVCFLPYHIFKPVFYVLHQREDCQQLNYLIETKNILTCLASARSSTDPIMYLLLDKTFKK 303
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
32-308 1.42e-18

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 83.51  E-value: 1.42e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599   32 GNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSA-MPFMGIYFLKGfQWEYQSAQCRVVNFLGTlsmhVSMFVSLLIL 110
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLtLPFWLVYALFG-TWPFGSALCKLVTALDV----VNGYASILLL 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  111 SWIAISRYATLMkkdstqettscyekifygHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEATEGEEKVCYnr 190
Cdd:pfam00001  76 TAISIDRYLAIV------------------HPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCL-- 135
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  191 qMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIrtctsITEKDLTYSSVKRH---LLVIQILLVVCFLPY 265
Cdd:pfam00001 136 -ITFPESLWPVSYLLFSTVVGFllPLLVILVCYTRIIRTLRKQ-----ARSRRRSVRSERKAlktLLVVVVVFILCWLPY 209
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....
gi 343962599  266 SIFKPIFFVLHQGK-DCQQLNYLIEIKNILTCLASARSSTDPII 308
Cdd:pfam00001 210 HILNLLDSLCDLLIiISCVVTPPRTLLQLTVWLAYSNSCLNPII 253
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
15-323 2.26e-14

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 72.89  E-value: 2.26e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  15 SMALPITYIFLCIIGLFGNsLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMgIYFLKGFQWEYQSAQCRVVNFL 94
Cdd:PHA03087  40 STILIVVYSTIFFFGLVGN-IIVIYVLTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQ-IYYYILFQWSFGEFACKIVSGL 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  95 gtlsMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYY 174
Cdd:PHA03087 118 ----YYIGFYNSMNFITVMSVDRYIA----------------IVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVY 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 175 SVveATEGEEKVCYnRQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRTCTSitekdlTYSSVKRhLL 252
Cdd:PHA03087 178 TT--KKDHETLICC-MFYNNKTMNWKLFINFEINIIGMliPLTILLYCYSKILITLKGINKSKK------NKKAIKL-VL 247
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 253 VIQILLVVCFLPY--SIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIVYNL 323
Cdd:PHA03087 248 IIVILFVIFWLPFnvSVFVYSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKS 320
 
Name Accession Description Interval E-value
7tmA_GPR82 cd14996
orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G ...
16-318 1.54e-168

orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the G-protein coupled receptor 82 of unknown function. GPR82 is a member of the rhodopsin-like, class A GPCRs, which is a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320127  Cd Length: 305  Bit Score: 475.45  E-value: 1.54e-168
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLG 95
Cdd:cd14996    1 VALPIIYSFLFVTGVFGNLLSLWVFLTKISKKTSTHIYLINLVTANLLVCSAMPFQAAYFLKGFYWKYQSTQCRIANFFG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 TLSMHVSMFVSLLILSWIAISRYATLMKKDSTQETTSCYEKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd14996   81 TLVIHVSMCVSILILSWIAISRYATLMKHDSATQKQSCYEKIFYGHFLKRFRQPKFARYLCIYIWGVVLCIIIPVVVYYS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQ 255
Cdd:cd14996  161 VREADEDGESLCYNRQVELGAKGSQIAGLIATTFFFLFFLVVLLSYYSFVNHLRRIQKNTCISEKDLIYRSVKRNILIIQ 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 256 ILLVVCFLPYSIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14996  241 ALLVVCFLPYHIFKPVFYVLHQREDCQQLNYLIETKNILTCLASARSSTDPIMYLLLDKTFKK 303
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
16-320 2.57e-59

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320113  Cd Length: 283  Bit Score: 195.18  E-value: 2.57e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLg 95
Cdd:cd14982    1 TLFPIVYSLIFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLFVLTLPFRIYYYLNGGWWPFGDFLCRLTGLL- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 tlsMHVSMFVSLLILSWIAISRYATLMKKdstqettscyekifygHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd14982   80 ---FYINMYGSILFLTCISVDRYLAVVHP----------------LKSRRLRRKRYAVGVCAGVWILVLAASVPLLLLRS 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVeATEGEEKVCYNRQMELGAmLSQIAGLIGTTFIGFSFLVVLTSYYSFVshLRKIRTCTSITEKDLTYSSVKRHLLVIQ 255
Cdd:cd14982  141 TI-AKENNSTTCFEFLSEWLA-SAAPLVLIALVVGFLIPLLIILVCYSLI--IRALRRRSKQSQKSVRKRKALRMILIVL 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 343962599 256 ILLVVCFLPYSIFKPIFFV--LHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd14982  217 AVFLVCFLPYHVTRILYLLvrLSVIADCSARNSLYKAYRITLCLASLNSCLDPLIYYFLSKTFRKRL 283
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
17-318 4.15e-28

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101  Cd Length: 282  Bit Score: 111.62  E-value: 4.15e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFqWEYQSAQCRVVnflgt 96
Cdd:cd14970    2 VIPAVYSVVCVVGLTGNSLVIYVILRYSKMKTVTNIYILNLAVADELFLLGLPFLATSYLLGY-WPFGEVMCKIV----- 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 LSM-HVSMFVSLLILSWIAISRY-ATLmkkdstqettscyekifygHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVIL 172
Cdd:cd14970   76 LSVdAYNMFTSIFCLTVMSVDRYlAVV-------------------HPVKslRFRTPRKAKLVSLCVWALSLVLGLPVII 136
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 173 YYSVVEATEGEEkVCyNRQMELGAMLSQIAGLIGTTFIGFS--FLVVLTSYYSFVSHLRKIR--TCTSITEKDLTYSSVK 248
Cdd:cd14970  137 FARTLQEEGGTI-SC-NLQWPDPPDYWGRVFTIYTFVLGFAvpLLVITVCYSLIIRRLRSSRnlSTSGAREKRRARRKVT 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 249 RHLLVIQILLVVCFLPYSIFKPIFFVLHQgkdcQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14970  215 RLVLVVVAVFVVCWLPFHVFQIVRLLIDP----PETLTVVGVFLFCIALSYANSCLNPILYAFLDENFRK 280
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
17-318 8.57e-25

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 320116  Cd Length: 284  Bit Score: 102.08  E-value: 8.57e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGT 96
Cdd:cd14985    2 VIPAFYIAIFLVGLLGNLFVVWLFLLPRGPKRVADIFIANLAAADLVFVLTLPLWATYTANQYDWPFGDFLCKVSSYAIT 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 LSMHVSMFvsllILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSV 176
Cdd:cd14985   82 VNMFASVF----LLTCMSVDRYLAIVHPVASR----------------RLRRRRQARVTCALIWVVACLLSLPTFLLRSL 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIgFSFLVVLTSYYSFVSHLRK---IRTCTSITEKDLTyssvkRHLLV 253
Cdd:cd14985  142 QALPDLNKTACIELYPHEAWHVGLSLVLNILGFV-LPLVIILTCYCHIARTLRThyeRTGKGGRKRRKSL-----KIIFA 215
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 343962599 254 IQILLVVCFLPYSIFKPIFFV--LHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14985  216 VVVAFLVCWLPFHVFKFLDFLaqLGAIRPCFWEAFLDLGLPIATCLAFTNSCLNPFIYVFFDRRFRQ 282
7tmA_GPR17 cd15161
G protein-coupled receptor 17, member of the class A family of seven-transmembrane G ...
22-317 3.76e-24

G protein-coupled receptor 17, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR17 is a Forkhead box protein O1 (FOXO1) target and abundantly expressed in agouti-related peptide (AGRP) neurons. FOXO1 is a transcription factor that plays key roles in regulation of gluconeogenesis and glycogenolysis by insulin signaling. For instance, food intake and body weight increase when hypothalamic FOXO1 is activated, whereas they both decrease when FOXO1 is inhibited. However, a recent study has been reported that GPR17 deficiency in mice did not affect food intake or glucose homeostasis. Thus, GPR17 may not play a role in the control of food intake, body weight, or glycemic control. GPR17 is phylogenetically closely related to purinergic P2Y and cysteinyl-leukotriene receptors.


Pssm-ID: 320289  Cd Length: 277  Bit Score: 100.17  E-value: 3.76e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  22 YIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtlsMHV 101
Cdd:cd15161    7 YILVFILAFPGNTLALWLFIHDRKSGTPSNVFLMHLAVADLSYVLILPMRLVYHLSGNHWPFGEVPCRLAGFL----FYL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 102 SMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEATe 181
Cdd:cd15161   83 NMYASLYFLACISVDRFLA----------------IVHPVKSMKIRKPLYAHVVCGFLWVIVTVAMAPLLVSPQTVEVN- 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 182 gEEKVC---YNRQMELGAMLSQIAGLIgttfigFSFLVVLTSYYSFvshLRKIRTCTSItEKDLTYSSVKRHLLVIQILL 258
Cdd:cd15161  146 -NTTVClqlYREKASRGALVSLAVAFT------IPFVTTVTCYLLI---IRSLRTGKRE-EKPLKDKAIKMIILVLTIFL 214
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 343962599 259 vVCFLPYSIFKPIFFVLHQG--KDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15161  215 -ICFVPYHISRYIYILSHNGagASCSSRRGLALANRITSCLTCLNGALDPVMYFFVAEKFR 274
7tmA_EBI2 cd15159
Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G ...
17-320 9.72e-23

Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Epstein-Barr virus-induced G-protein coupled receptor 2 (EBI2), also called GPR183, is activated by 7alpha, 25-dihydroxyxcholesterol (7alpha, 25-OHC), an oxysterol. EBI2 was originally identified as one of major genes induced in the Burkitt's lymphoma cell line BL41by EBV infection. EBI2 is involved in regulating B cell migration and responses, and is also implicated in human diseases such as type I diabetes, multiple sclerosis, and cancers.


Pssm-ID: 320287  Cd Length: 286  Bit Score: 95.88  E-value: 9.72e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgt 96
Cdd:cd15159    2 LLPLFYSLILVFGLLGNTLALHVICQKRKKINSTTLYLINLAVSDILFTLALPGRIAYYALGFDWPFGDWLCRLTALL-- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 lsMHVSMFVSLLILSWIAISRYATLMKKdstqettscyekifygHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILyySV 176
Cdd:cd15159   80 --FYINTYAGVNFMTCLSVDRYIAVVHP----------------LRRHRLRKVKVVRYICVFVWVLVFLQTLPLLF--MP 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCynrqMELgAMLSQIAG----LIGTTFIGFSFLV--VLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRH 250
Cdd:cd15159  140 MTKEMGGRITC----MEY-PNFEKIKRlpliLLGACVIGFGVPVgiILFCYSQITLKLCRTAKENPLTEKSGHHKKACNV 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 343962599 251 LLVIQILLVVCFLPYSIFKPIFFV--LHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15159  215 ILLVLLVFVVCFSPYHLNIIQFMIrkLLYQPSCSELKAFKISLQITVCLMNLNCCLDPFIYFFACKGYKKKV 286
7tmA_CysLTR2 cd15157
cysteinyl leukotriene receptor 2, member of the class A family of seven-transmembrane G ...
16-317 1.16e-21

cysteinyl leukotriene receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320285  Cd Length: 278  Bit Score: 92.85  E-value: 1.16e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFlg 95
Cdd:cd15157    1 VIYPTVYLIIFVLGVVGNGLSIYVFLQPSKKKTSVNIFMLNLAVSDLMFVSTLPFRADYYLMGSHWVFGDIACRIMSY-- 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 tlSMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd15157   79 --SLYVNMYCSIYFLTVLSIVRFLA----------------IVHPFKLWKVTSIKYARILCAVIWIFVMAASSPLLSKGT 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 vveATEGEEKVCYNRQMELGAMLSQIAGLIgtTFIGFS--FLVVLTSYYSFVSHLRKIRTCTSitEKDLTYSSVKRHLLV 253
Cdd:cd15157  141 ---SKYNSQTKCLDLHPSKIDKLLILNYIV--LVVGFIlpFCTLSICYILIIKALLKPRVPQS--KLRVSHKKALLTIII 213
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 343962599 254 IQILLVVCFLPYSIFKPIFfvLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15157  214 TLILFLLCFLPYHILRTVH--LMQWSEGQCNLRLHKAVVITLCLAAANSCLDPLLYYFAGENFK 275
7tmA_NOFQ_opioid_R cd15092
nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G ...
20-317 1.09e-20

nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The nociceptin (NOP) receptor binds nociceptin or orphanin FQ, a 17 amino acid endogenous neuropeptide. The NOP receptor is involved in the modulation of various brain activities including instinctive and emotional behaviors. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320220  Cd Length: 279  Bit Score: 89.93  E-value: 1.09e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  20 ITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFqWEYQSAQCRVVNFLGtlsm 99
Cdd:cd15092    5 VVYLIVCVVGLVGNCLVMYVIVRYTKMKTATNIYIFNLALADTLVLLTLPFQGTDIFLGF-WPFGNALCKIVIAID---- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 100 HVSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLKKF--RQPNFARKLCVYIWVVVLGIIIPVILYYSVv 177
Cdd:cd15092   80 YYNMFTSTFTLTMMSVDRYVAIC------------------HPIKALdiRTPHKAKVVNVCIWALASVIGVPVMVMGSA- 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 eATEGEEKVCYnrqMELGAMLSQIAGLIGTTFIGFSFLV---VLTSYYSF-VSHLRKIRTCTSITEKDLTYSSVKRHLLV 253
Cdd:cd15092  141 -QVENEEIECL---VEIPTPQDYWDPVFGICVFLFSFIIpvlIISVCYSLmIRRLRGVRVLSGSKEKDRNLRRITRLVLV 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 254 IQILLVVCFLPYSIfkpifFVLHQGKDCQQLNYL-IEIKNILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15092  217 VVAVFVICWTPIQI-----FVLAQSLGAKPSSELaVAILHFCTALGYVNSSLNPVLYAFLDENFK 276
7tmA_GPR34-like cd15148
putative G protein-coupled receptor 34, member of the class A family of seven-transmembrane G ...
17-320 2.61e-20

putative G protein-coupled receptor 34, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the G-protein coupled receptor 34 of unknown function. Orphan GPR34 is a member of the rhodopsin-like, class A GPCRs, which is a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320276  Cd Length: 282  Bit Score: 88.98  E-value: 2.61e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVnflGT 96
Cdd:cd15148    2 PLAVFYSLIFLFGLVGNLLALWVFLFIHRKRNSVRIFLINVAIADLLLIICLPFRILYHVNNNQWTLGPLLCKVV---GN 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 LsMHVSMFVSLLILSWIAISRYATLMKKDSTQETTSCYEKIFyghllkkfrqpnfarkLCVYIWVVVLGIIIPVIlyysV 176
Cdd:cd15148   79 L-FYMNMYISIILLGFISLDRYLKINRSSRRQKFLTRKWSIV----------------ACGVLWAVALVGFVPMI----V 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQI 256
Cdd:cd15148  138 LTEKNEESTKCFQYKDRKNAKGKAIFNFLIVAMFWLVFLLLILSYGKIAKKLLRISRDKPDFPNAAKYNRTARKSFFVLF 217
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 343962599 257 LLVVCFLPYSIFKpIFFVLHQGKD--CQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15148  218 IFTVCFVPYHAFR-IFYITSQLQNnsCYWKEILHKTNEIMLLLSAFNSCLDPVMYFLLSSSIRKVT 282
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
18-316 9.88e-20

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 320296  Cd Length: 283  Bit Score: 86.99  E-value: 9.88e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15168    3 LPIVYGVVFLVGLLLNAVVLYRFIFSLKPWNSSAIYMFNLAVSDLLYLLSLPFLIYYYANGDHWIFGDFMCKLVRFL--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLmkkdstqettsCYEkiFYGHLLKKFRqpnFARKLCVYIWVVVLGIIIPvILYYSVV 177
Cdd:cd15168   80 -FYFNLYCSILFLTCISVHRYLGI-----------CHP--MRSLRKLKKR---HAVAVCVAVWILVLLQLLP-ILFFATT 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEgEEKVCYN--RQMELGAMLSQIAGLIGTTFiGFSFLVVLTSYYSFVSHLrkirtCTSITEKDLTYSSVKRHLLVIQ 255
Cdd:cd15168  142 GRPN-NRTTCYDttSPEELNDYVPYSMVLTGLGF-LLPLLIILACYGLIARTL-----LRSLGSGVTSALRRKSIRLVIV 214
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 256 ILLV--VCFLPYSIFKPIF--FVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTF 316
Cdd:cd15168  215 VLALfaVCFLPFHVTRTIYlaARLLSGTSCATLNGIYVAYKVTRPLASLNSCLNPLLYFLTGDKF 279
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
20-318 2.02e-19

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222  Cd Length: 282  Bit Score: 86.37  E-value: 2.02e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  20 ITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMgIYFLKGFQWEYQSAQCRVvnFLGTLSm 99
Cdd:cd15094    5 VLYGLICIVGLVGNGLVIYVVLRYAKMKTVTNLYILNLAVADECFLIGLPFL-IVTMILKYWPFGAAMCKI--YMVLTS- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 100 hVSMFVSLLILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEA 179
Cdd:cd15094   81 -INQFTSSFTLTVMSADRYLAVCHPIRSM----------------RYRTPFIAKVVCATTWSISFLVMLPIILYASTVPD 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 180 TEGeeKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTS--YYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQIL 257
Cdd:cd15094  144 SGR--YSCTIVWPDSSAVNGQKAFTLYTFLLGFAIPLLLISvfYTLVILRLRTVGPKNKSKEKRRSHRKVTRLVLTVISV 221
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 343962599 258 LVVCFLPYSIFKpiFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15094  222 YIICWLPYWAFQ--VHLIFLPPGTDMPKWEILMFLLLTVLSYANSMVNPLLYAFLSENFRK 280
7tmA_PAR cd15162
protease-activated receptors, member of the class A family of seven-transmembrane G ...
18-317 3.03e-19

protease-activated receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes purinergic receptor P2Y8 and protease-activated receptors. P2Y8 (or P2RY8) expression is often increased in leukemia patients, and it plays a role in the pathogenesis of acute leukemia. P2Y8 is phylogenetically closely related to the protease-activated receptors (PARs), which are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. Four different types of the protease-activated receptors have been identified (PAR1-4) and are predominantly expressed in platelets. PAR1, PAR3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320290  Cd Length: 280  Bit Score: 85.57  E-value: 3.03e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVnflgTL 97
Cdd:cd15162    3 VPAVYTLVFVVGLPANGMALWVLAFRTKRKTPSVVFMMNLAIADLLLALALPFKIAYHLRGNNWIFGEALCRLV----TV 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 SMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15162   79 AFYGNMYCSILLMTCISIDRYLA----------------VVHPMRARALRGRRYALGTCLAIWALALLLALPLTLQKQTY 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVCY---NRQMELGAMLSQIAGLigttFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVI 254
Cdd:cd15162  143 RLPRLDITTCHdvlPEDLLAGHWQYYFLSL----ALVGFLIPFILTLLCYVATIRTLAASASRYSGKRKGRALKLSAVVL 218
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 255 QIlLVVCFLPYSIFKPI--FFVLHQGKDCQQLNYLIEIkniltCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15162  219 AI-FIICFAPSNLLLLAhySDPSPSATGNLYFAYLLAL-----CLSSLNSCIDPFIYYYASKEFR 277
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
20-312 3.47e-19

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 85.40  E-value: 3.47e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  20 ITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVC-SAMPFMGIYFLKGFqWEYQSAQCRVVNFLgtls 98
Cdd:cd00637    3 VLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGlLVIPFSLVSLLLGG-WWFGDALCKLLGFL---- 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  99 MHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVE 178
Cdd:cd00637   78 QTVSLTASILTLTAISVDRYLA----------------IVHPLRYRRRFTKRRAKLVIALIWLLSLLLALPPLLGWKVYE 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 179 ATEGEEKVCYNRQMELGAMLSqiaGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQILL 258
Cdd:cd00637  142 YGGYCCCCLCWPDLTLSKAYT---IFLFVLLFLLPLLVIIVCYVRIFRKLRRHRKRISSSSNSSRRRRRRRERKVTKMLL 218
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 259 VV------CFLPYSIFKPIFFVLHqgkdcQQLNYLIEIKNILTCLASARSSTDPIIFLFL 312
Cdd:cd00637  219 IVvvvfllCWLPYFILFLLDVFGP-----DPSPLPRILYFLALLLAYLNSAINPIIYAFF 273
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
18-313 4.29e-19

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320095  Cd Length: 270  Bit Score: 85.15  E-value: 4.29e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLL-VCSAMPFMGIYFLKGFqWEYQSAQCRVVNFLgt 96
Cdd:cd14964    1 LFVLLLLIFLLGLLGNLLVLLVILRSRRLRTPTNLFLLNLALADLLfSLVVVPFLLLGLLSGE-WSFGFAGCKLVLFF-- 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 lsMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSV 176
Cdd:cd14964   78 --FYLFGFASIFLLTAMAIDRYLA----------------ICHPLKYTVLMTPRRARLLILGIWVLSLLLSLPPLLGWGT 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCynrQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSS-VKRHLLV 253
Cdd:cd14964  140 LPFCGPNVPLL---TLSCSDTAWNIAYTLGLLILGFllPLLLILVSYARIVRALLRRKRITRSAISSARRERkAFKTLLI 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 254 IQILLVVCFLPYSIFkpiFFVLHQGKDCQQLNYLieiKNILTCLASARSSTDPIIFLFLD 313
Cdd:cd14964  217 VVLVFLLCWLPYHIV---YLLPALLQLSNSLPLL---LLLSVLLAVLNSCLNPLIYSLRN 270
7tmA_GPR34-like cd15920
P2Y-like receptor and similar proteins, member of the class A family of seven-transmembrane G ...
18-320 6.00e-19

P2Y-like receptor and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR34 is phylogenetically related to the P2Y family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. GPR34 is shown to couple to G(i/o) protein and is highly expressed in microglia. Recently, lysophosphatidylserine has been identified as a ligand for GPR34. This group belongs to the class A G protein-coupled receptor superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, which then activate the heterotrimeric G proteins. G-proteins regulate a variety of cellular functions including metabolic enzymes, ion channels, and transporters, among many others.


Pssm-ID: 320586  Cd Length: 278  Bit Score: 84.85  E-value: 6.00e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYflkgFQWEYQSAQCRVVNflgtL 97
Cdd:cd15920    3 LPVMYSIICIVGLLSNTLALWVFFLRQQRETSISVYMRNLALADLLLVLCLPFRVAY----QNTAGPLSFCKIVG----A 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 SMHVSMFVSLLILSWIAISRYATLMKKdstqettscyekifyghlLKKFR--QPNFARKLCVYIWVVVLGIIIPviLYYS 175
Cdd:cd15920   75 FFYLNMYASILFLSLISLDRYLKIIKP------------------LQQFKihTVPWSSAASGGVWLLLLACMIP--FLFE 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYNRQMELGAMLSQIAGLIgttfIGFSFLVVLTSYYSFVSHlrKIRTCTSITEKDLTYSSVKRHLL--- 252
Cdd:cd15920  135 SRNEGPCDNKCFHFRSKGLTAGGINLTAVV----IFYILSLLFLYFYAKISH--KLYKVSLGNAQQQIKKASKRAIIktf 208
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 343962599 253 VIQILLVVCFLPYSIFKpIFFVLHQGK---DCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15920  209 IVLAIFIVCFVPYHIVR-VPYVLAQIDvisSLPWKQTLHIANELVLCLSALNSCLDPIIYFFLSSSFRRAV 278
7tmA_Bradykinin_R cd15189
bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
21-320 6.81e-19

bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320317  Cd Length: 284  Bit Score: 84.83  E-value: 6.81e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  21 TYIF-LCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNflgtLSM 99
Cdd:cd15189    5 PFIFsLCLFGLLGNLFVLLVFLLHRRRLTVAEIYLGNLAAADLVFVSGLPFWAMNILNQFNWPFGELLCRVVN----GVI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 100 HVSMFVSLLILSWIAISRYATLMKKDSTqettscyekifyghllKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEA 179
Cdd:cd15189   81 KVNLYTSIYLLVMISQDRYLALVKTMAA----------------RRLRRRRYAKLICVLIWVVGLLLSIPTFLLRKIKAI 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 180 TEGEEKVCYnrqMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRTCTSIteKDLTYSSVKRHLLVIQIL 257
Cdd:cd15189  145 PDLNITACV---LLYPHEAWHFAHIVLLNIVGFllPLLVITFCNYNILQALRTREESTRC--EDRNDSKATALVLAVTLL 219
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 258 LVVCFLPY--SIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15189  220 FLVCWGPYhfFTFLDFLFDVGVLDECFWEHFIDIGLQLAVFLAFSNSCLNPVLYVFVGRYFRRKV 284
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
32-308 1.42e-18

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 83.51  E-value: 1.42e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599   32 GNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSA-MPFMGIYFLKGfQWEYQSAQCRVVNFLGTlsmhVSMFVSLLIL 110
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLtLPFWLVYALFG-TWPFGSALCKLVTALDV----VNGYASILLL 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  111 SWIAISRYATLMkkdstqettscyekifygHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEATEGEEKVCYnr 190
Cdd:pfam00001  76 TAISIDRYLAIV------------------HPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCL-- 135
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  191 qMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIrtctsITEKDLTYSSVKRH---LLVIQILLVVCFLPY 265
Cdd:pfam00001 136 -ITFPESLWPVSYLLFSTVVGFllPLLVILVCYTRIIRTLRKQ-----ARSRRRSVRSERKAlktLLVVVVVFILCWLPY 209
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....
gi 343962599  266 SIFKPIFFVLHQGK-DCQQLNYLIEIKNILTCLASARSSTDPII 308
Cdd:pfam00001 210 HILNLLDSLCDLLIiISCVVTPPRTLLQLTVWLAYSNSCLNPII 253
7tmA_Proton-sensing_R cd15160
proton-sensing G protein-coupled receptors, member of the class A family of ...
18-317 4.00e-18

proton-sensing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Proton/pH-sensing G-protein coupled receptors sense pH of 7.6 to 6.0. They mediate a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. The proton/pH-sensing receptor family includes the G2 accumulation receptor (G2A, also known as GPR132), the T cell death associated gene-8 (TDAG8, GPR65) receptor, ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4).


Pssm-ID: 320288  Cd Length: 280  Bit Score: 82.43  E-value: 4.00e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15160    3 LPVVYSFVFVVGLPANCLALWVLYLQIKKENVLGVYLLNLSLSDLLYILTLPLWIDYTANHHNWTFGPLSCKVVGFF--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15160   80 -FYTNIYASIGFLCCIAVDRYLA----------------VVHPLRFRGLRTRRFALKVSASIWVLELGTHSVFLGHDELF 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EaTEGEEKVCYNR-QMElgamLSQIAGLIGTTFIGFSF-LVVLTSYYSFVshLRKIRTCTSiTEKDlTYSSVKRHLLVIQ 255
Cdd:cd15160  143 R-DEPNHTLCYEKyPME----GWQASYNYARFLVGFLIpLSLILFFYRRV--LRAVRQSPS-LERE-EKRKIIGLLLSIV 213
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 343962599 256 ILLVVCFLPYSIfkpIFFVLHQGKDCQQLNYLIEIK-----NILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15160  214 VIFLLCFLPYHV---VLLVRSVIELVQNGLCGFEKRvftayQISLCLTSLNCVADPILYIFVTEDVR 277
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
18-318 6.22e-18

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 320318  Cd Length: 292  Bit Score: 82.11  E-value: 6.22e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGTL 97
Cdd:cd15190    3 IPVIYMLVFVLGLSGNGLVIWTVFRSKAKRRSADTFIANLALADLTFVVTLPLWAVYTALGYHWPFGSFLCKLSSYLVFV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 SMHVSMFVslliLSWIAISRYATLMKKDSTqettscyekifyghllKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15190   83 NMYASVFC----LTCLSFDRYLAIVRSLAS----------------AKLRSRTSGIVALGVIWLLAGLLALPALILRTTR 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVC---YNRQMELGAMLSQIAGL-IGTTFIGFSF-LVVLTSYYSFVShlrkiRTCTSITEKDLTYSSVKRHLL 252
Cdd:cd15190  143 ELDGSNKTICdmdFSGVVSNEAELFWIAGLgLSSTVLGFLLpFLVMLTCYFFIG-----RTVARHFSKERKELKKKRRLL 217
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 253 VIQILLVV----CFLPYSIFKPIFFVLHQGK---DCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15190  218 KIIITLVVtfalCWLPFHLVKTIYALMYLGIlpfSCGFDQFLVNAHPYATCLAYVNSCLNPFLYAFFDPRFRQ 290
7tmA_P2Y2 cd15373
P2Y purinoceptor 2, member of the class A family of seven-transmembrane G protein-coupled ...
18-318 6.26e-18

P2Y purinoceptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y2 belongs to the P2Y receptor family of purinergic G-protein coupled receptors and is implicated to play a role in the control of the cell cycle of endometrial carcinoma cells. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320495  Cd Length: 283  Bit Score: 82.11  E-value: 6.26e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15373    3 LPVSYGIVFVVGLVLNILALYVFLFRTKPWNASTTYMFNLAISDTLYVLSLPLLVYYYADENDWPFSEALCKIVRFL--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLmkkdstqettsCY--EKIFYGHLlkkfrqpNFARKLCVYIWVVVLGIIIPViLYYS 175
Cdd:cd15373   80 -FYTNLYCSILFLLCISVHRFLGV-----------CYpvRSLRWLKV-------RYARIVSVVVWVIVLACQSPV-LYFV 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGeEKVCYN-RQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSvkRHLLVI 254
Cdd:cd15373  140 TTSDKGG-NITCHDtSSPELFDQFVVYSSVMLVLLFCVPFVVILVCYALMVRKLLKPSAGTSTNSRSKKKSV--KMIIIV 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 255 QILLVVCFLPYSIFKPIFFVLHQ-GKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15373  217 LAVFILCFLPFHVTRTLYYSFRSmDLSCGTLNAINLAYKVTRPLASANSCLDPILYFLAGQSFRS 281
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
17-318 9.47e-18

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221  Cd Length: 280  Bit Score: 81.35  E-value: 9.47e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFqWEYQSAQCRVVnflgt 96
Cdd:cd15093    2 LIPCIYAVVCLVGLCGNSLVIYVVLRYAKMKTVTNIYILNLAIADELFMLGLPFLAASNALRH-WPFGSVLCRLV----- 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 LSMH-VSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVILY 173
Cdd:cd15093   76 LSVDgINMFTSIFCLTVMSVDRYLAVV------------------HPIKsaRWRRPRVAKVVNLAVWVASLLVILPVVVF 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 174 YSVVEATEGeeKVCYNRQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHL 251
Cdd:cd15093  138 AGTRENQDG--SSACNMQWPEPAAAWSAGFIIYTFVLGFllPLLIICLCYLLIVIKVKSAGLRAGWQQRKRSERKVTRMV 215
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 343962599 252 LVIQILLVVCFLPYSIFK--PIFFVLHQGKDCQQLNYLIEIkniltcLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15093  216 VMVVVVFVICWLPFYVLQlvNVFVQLPETPALVGVYHFVVI------LSYANSCANPILYGFLSDNFKK 278
7tmA_P2Y4 cd15374
P2Y purinoceptor 4, member of the class A family of seven-transmembrane G protein-coupled ...
18-318 1.07e-17

P2Y purinoceptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y4 belongs to the P2Y receptor family of purinergic G-protein coupled receptors. This family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320496  Cd Length: 285  Bit Score: 81.39  E-value: 1.07e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15374    3 LPVSYGLVFVVGLPLNATALWLFIKRMRPWNPTTVYMFHLALSDTLYVLSLPTLIYYYADHNHWPFGVVACKIVRFL--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLKKFR--QPNFARKLCVYIWVVVLGIIIPVILYys 175
Cdd:cd15374   80 -FYANLYCSILFLTCISVHRYVGIC------------------HPIRALRwvKPRHAYLICASVWLVVTVCLVPNLIF-- 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYN-RQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVI 254
Cdd:cd15374  139 VTTSRKDNITLCHDtTRPEEFDHYVHYSSAVMVLLFGIPCLVIVVCYGLMARRLCKPRVGSSRQQGPSSKKRSLKTIIMV 218
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 255 QILLVVCFLPYSIFKPIFFVLH-QGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15374  219 LTVFAICFVPFHITRTLYYVARlLKADCDTLNIINVTYKVTRPLASANSCLDPILYFLAGDKYRR 283
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
21-318 2.41e-17

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105  Cd Length: 274  Bit Score: 80.04  E-value: 2.41e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  21 TYIFLCIIGLFGNSLSQWIfLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtlsMH 100
Cdd:cd14974    6 LYALIFLLGLPGNGLVIWV-AGFKMKRTVNTVWFLNLALADFLFCLFLPFLIVYIAMGHHWPFGSVLCKLNSFV----IS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 101 VSMFVSLLILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEaT 180
Cdd:cd14974   81 LNMFASVFLLTAISLDRCLLVLHPVWAQ----------------NHRTVRLASVVCVGIWILALVLSVPYFVFRDTVT-H 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 181 EGEEKVCYNRQMELGAMLSQIAGLIGTTFI-GFS--FLVVLTSYYSFVSHLRKIRTCTSitekdltyssvKRHLLVIQIL 257
Cdd:cd14974  144 HNGRSCNLTCVEDYDLRRSRHKALTVIRFLcGFLlpLLIIAICYSVIAVKLRRKRLAKS-----------SKPLRVLLAV 212
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 343962599 258 LV---VCFLPYSIFkpIFFVLHQGKDCQQLNYLIEikNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14974  213 VVaffLCWLPYHVF--ALLELVAAAGLPEVVLLGL--PLATGLAYFNSCLNPILYVFMGQDFRK 272
7tmA_PAR4 cd15372
protease-activated receptor 4, member of the class A family of seven-transmembrane G ...
18-317 1.74e-16

protease-activated receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; Protease-acted receptors (PARs) are seven-transmembrane proteins that belong to the class A G-protein coupled receptor (GPCR) family. Four different types of the protease-activated receptors have been identified: PAR1, PAR2, PAR3, and PAR4. PARs are predominantly expressed in platelets and are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320494  Cd Length: 274  Bit Score: 77.87  E-value: 1.74e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSThIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVnflgTL 97
Cdd:cd15372    3 VPSLYTLVFLVGLPANGLALWVLATQVKRLPST-IFLINLAVADLLLILVLPFKISYHFLGNNWPFGEGLCRVV----TA 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 SMHVSMFVSLLILSWIAISRYATLMKKdstqettscyekiFYGhllKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15372   78 FFYGNMYCSVLLLMCISLDRYLAVVHP-------------FFA---RTLRSRRFALCMCTAIWLIAAALTLPLTLQRQSY 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVCYN---RQMELGAMLSQIAGLIGTTFIgFSFLVVLTSYYSFvshlrkIRTCTSITEKdltYSSVKRHLLVI 254
Cdd:cd15372  142 PLERLNITLCHDvlpLDEQDTYLFYYFACLAVLGFL-LPLVVILFCYGSV------LHTLLRSGQR---YGHAMKLTVLV 211
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 255 QILLVVCFLPYSIFKPIFFVLHQGKDCQQLnYLIEIknILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15372  212 LVSFVLCFTPSNLLLLLHYSDPTLDDGGNL-YIVYM--VSLAISTLNSCVDPFIYYYVSEEFR 271
7tmA_HCAR-like cd14991
hydroxycarboxylic acid receptors and related proteins, member of the class A family of ...
17-318 2.87e-16

hydroxycarboxylic acid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the hydroxycarboxylic acid receptors (HCARs) as well as their closely related receptors, GPR31 and oxoeicosanoid receptor 1 (OXER1). HCARs are members of the class A family of G-protein coupled receptors (GPCRs). HCAR subfamily contain three receptor subtypes: HCAR1, HCAR2, and HCAR3. The endogenous ligand of HCAR1 (also known as lactate receptor 1, GPR104, or GPR81) is L-lactic acid. The endogenous ligands of HCAR2 (also known as niacin receptor 1, GPR109A, nicotinic acid receptor) and HCAR3 (also known as niacin receptor 2, orGPR109B) are 3-hydroxybutyric acid and 3-hydroxyoctanoic acid, respectively. All three HCA receptors are expressed in adipocytes, and are coupled to G(i)-proteins mediating anti-lipolytic effects in fat cells. OXER1 is a receptor for eicosanoids and polyunsaturated fatty acids such as 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid (5-OXO-ETE), 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HPETE) and arachidonic acid, whereas GPR31 is a high-affinity receptor for 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (12-S-HETE).


Pssm-ID: 320122  Cd Length: 280  Bit Score: 77.49  E-value: 2.87e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgt 96
Cdd:cd14991    2 ILPPLLILEFVLGLPGNVVALWIFCFHSRTWKANTVYLFNLVLADFLLLICLPFRIDYYLRGEHWIFGEAWCRVNLFM-- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 LSMHVSmfVSLLILSWIAISRYAtlmkkdstqettscyeKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILyySV 176
Cdd:cd14991   80 LSVNRS--ASIAFLTAVALDRYF----------------KVVHPHHRVNRMSVKAAAGVAGLLWALVLLLTLPLLL--ST 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCynRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSItEKDLTYSSVKRHLLVIQI 256
Cdd:cd14991  140 LLTVNSNKSSC--HSFSSYTKPSLSIRWHNALFLLEFFLPLGLIVFCSVRIACNLRIRQSL-GKQARVQRAIRLVFLVVI 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 343962599 257 LLVVCFLPYSIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14991  217 VFVLCFLPSIIAGLLALVFKNLGSCRCLNSVAQLFHISLAFTYLNSALDPVIYCFSSPWFRN 278
7tmA_Delta_opioid_R cd15089
opioid receptor subtype delta, member of the class A family of seven-transmembrane G ...
16-318 3.74e-16

opioid receptor subtype delta, member of the class A family of seven-transmembrane G protein-coupled receptors; The delta-opioid receptor binds the endogenous pentapeptide ligands such as enkephalins and produces antidepressant-like effects. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320217  Cd Length: 281  Bit Score: 76.91  E-value: 3.74e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGfQWEYQSAQCRVVnflg 95
Cdd:cd15089    1 IAITALYSVVCVVGLLGNVLVMYGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLME-TWPFGELLCKVV---- 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 tLSM-HVSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVIL 172
Cdd:cd15089   76 -LSIdYYNMFTSIFTLTMMSVDRYIAVC------------------HPVKalDFRTPAKAKLINICIWVLSSGVGVPIMV 136
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 173 YysVVEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSF--LVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRH 250
Cdd:cd15089  137 M--AVTKTPRDGTVVCMLQFPDPSWYWDTVTKICVFIFAFVVpiLVITVCYGLMILRLRSVRLLSGSKEKDRNLRRITRM 214
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 343962599 251 LLVIQILLVVCFLPYSIFKPIFFVLhqgkDCQQLN-YLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15089  215 VLVVVAAFIICWTPIHIFVIVWTLV----DIDKRNpLVVASLHLCIALGYTNSSLNPVLYAFLDENFKR 279
7tmA_C5aR cd15114
complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of ...
23-318 3.75e-16

complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320242  Cd Length: 274  Bit Score: 77.06  E-value: 3.75e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  23 IFLciIGLFGNSLSQWIfLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGTLsmhvS 102
Cdd:cd15114   10 VFL--VGVPGNALVAWV-TGFEAKRSVNAVWFLNLAVADLLCCLSLPILAVPIAQDGHWPFGAAACKLLPSLILL----N 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 103 MFVSLLILSWIAISRYATLMKKDSTQEttscyekifyghllkkFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEATEG 182
Cdd:cd15114   83 MYASVLLLTAISADRCLLVLRPVWCQN----------------HRRARLAWIACGAAWLLALLLTVPSFIYRRIHQEHFP 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 183 EEKVC---YNRQMELGAMLSQIAGLIGttFIGfsFLVVLTSYYSFVSHLRKIRTCTSITekdltyssvkRHLLVIQILLV 259
Cdd:cd15114  147 EKTVCvvdYGGSTGVEWAVAIIRFLLG--FLG--PLVVIASCHGVLLVRTWSRRRQKSR----------RTLKVVTAVVV 212
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 343962599 260 ---VCFLPYSIFKPIFFVLHQGKDCQQLnyLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15114  213 gffLCWTPYHVVGLIIAASAPNSRLLAN--ALKADPLTVSLAYINSCLNPIIYVVAGRGFRK 272
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
22-318 4.34e-16

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636  Cd Length: 276  Bit Score: 76.87  E-value: 4.34e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  22 YIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGfQWEYQSAQCRVVnflgtLSMH- 100
Cdd:cd15970    7 YSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR-HWPFGSLLCRLV-----LSVDa 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 101 VSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVE 178
Cdd:cd15970   81 INMFTSIYCLTVLSIDRYIAVV------------------HPIKaaRYRRPTVAKMVNLGVWVFSILVILPIIIFSNTAP 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 179 ATEGeeKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLV--VLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQI 256
Cdd:cd15970  143 NSDG--SVACNMQMPEPSQRWLAVFVVYTFLMGFLLPViaICLCYILIIVKMRVVALKAGWQQRKRSERKITLMVMMVVT 220
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 257 LLVVCFLPYSIFKPI-FFVLHQGKDCQQLNYLieikniltcLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15970  221 VFVICWMPFYVVQLVsVFVGQHDATVSQLSVI---------LGYANSCANPILYGFLSDNFKR 274
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
18-318 1.42e-15

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321  Cd Length: 279  Bit Score: 75.17  E-value: 1.42e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15193    3 IPILYLIIFFTGLLGNLFVIALMSKRSTTKRLVDTFVLNLAVADLVFVLTLPFWAASTALGGQWLFGEGLCKLSSFI--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLMKkdstqettscyekifyGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15193   80 -IAVNRCSSILFLTGMSVDRYLAVVK----------------LLDSRPLRTRRCALITCCIIWAVSLVLGIPSLVYRNLI 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 eategEEKVCYNRQMELGAMLSQIAGLIGTtfIGFSFLVVLTSYYSFVSHLRkiRTCTSITEKDLTYSSVKRHLLVIQIL 257
Cdd:cd15193  143 -----NESVCVEDSSSRFFQGISLATLFLT--FVLPLIVILFCYCSILVRLR--RHFHGAKRTGRRRRNSLRIVFAIVTA 213
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 343962599 258 LVVCFLPYSIFKPIFFVLHQGK---DCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15193  214 FVLSWLPFNTLKAVRLLLELGGgvlPCHTTVAIRQGLTITACLAFVNSCVNPLIYSLLDRHFRR 277
7tmA_PAR2 cd15370
protease-activated receptor 2, member of the class A family of seven-transmembrane G ...
18-317 2.55e-15

protease-activated receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Protease-acted receptors (PARs) are seven-transmembrane proteins that belong to the class A G-protein coupled receptor (GPCR) family. Four different types of the protease-activated receptors have been identified: PAR1, PAR2, PAR3, and PAR4. PARs are predominantly expressed in platelets and are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320492  Cd Length: 280  Bit Score: 74.83  E-value: 2.55e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRV-VNFLgt 96
Cdd:cd15370    3 LPVVYIIVFIVGLPSNAMAIWVFLFRTKKKHPSVIYMANLALADLLFVIWFPLKIAYHLNGNNWIFGEALCKVlVGFF-- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 lsmHVSMFVSLLILSWIAISRYATLMKKDSTQEttscyekifyghllkkfRQPNFARKLCVYIWVVVLGIIIPVILYYSV 176
Cdd:cd15370   81 ---YGNMYCSILFMTCLSVQRYWVIVNPISHSR-----------------RNNRIALGVSLAIWLVILLGTIPLYLVNQT 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSyysfVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQI 256
Cdd:cd15370  141 VYISDLNITTCHDVLPESLLSLDMFNYFLSLAIGVFLVPALLTA----VAYVLMIRTLKSSINDESIGKKRKRAIKLIVT 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 343962599 257 LLV---VCFLPYSIFKPIFFVL--HQGKDCQQLNYLIEIkniltCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15370  217 VLVmylVCFTPSNVLLVVHYALlkNGVQSSLYAFYITAL-----CLSSLNSCIDPFVYYFISKDFR 277
7tmA_P2Y1 cd15377
P2Y purinoceptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
18-318 3.23e-15

P2Y purinoceptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y1 belongs to the P2Y receptor family of purinergic G-protein coupled receptors. This family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320499  Cd Length: 284  Bit Score: 74.55  E-value: 3.23e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15377    3 LPTVYILVFITGFLGNSVAIWMFVFHMRPWSSISVYMFNLALADFLYVLSLPALIFYYFNKTDWIFGDVLCKLQRFI--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYatlmkkdstqeTTSCYEKIFYGHLLKKfrqpnFARKLCVYIWVVVLGIIIPvILYYSVV 177
Cdd:cd15377   80 -FHVNLYGSILFLTCISVHRY-----------TGVVHPLKSLGRLKKK-----NAVYISALVWLLVIVAISP-ILFYSGT 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVCYNRQMElGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLrkirtctsiTEKDLTYSSVKRH--LLV 253
Cdd:cd15377  142 GVRKNKTITCYDTTSD-EYLRSYFIYSMCTTVFGFcvPFILILGCYGLIVKAL---------IYKDMNNAPLRRKsiYLV 211
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 343962599 254 IQILLV--VCFLPYSIFKPI----FFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15377  212 IIVLTVfaVSYLPFHVMKNLnlraRLDFQTPDMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRR 282
7tmA_BK-1 cd15380
bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled ...
18-320 3.94e-15

bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320502  Cd Length: 286  Bit Score: 74.06  E-value: 3.94e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNflgtL 97
Cdd:cd15380    3 LPTFIIAICFFGLLGNLFVLFVFLLPRRRLTIAEIYLANLAASDLVFVLGLPFWAENIRNQFNWPFGNFLCRVIS----G 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 SMHVSMFVSLLILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15380   79 VIKANLFISIFLVVAISQDRYRTLVHTMTSR----------------RQRSRRQAQVICLLIWVFGGLLSIPTFLFRSVK 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVCYnrqMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVShLRKIRTCTSITEK---DLTYSSVKRHLLVI 254
Cdd:cd15380  143 HVPDLNISACI---LLFPHEAWHFARRVELNIVGFLLPLAAIVFFNFHI-IASLRERTEESRKrcgGLKDTKATRLILTL 218
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 343962599 255 QILLVVCFLPYS--IFKPIFFVLHQGKDCqQLNYLIEIKNIL-TCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15380  219 VLMFLVCWTPYHffAFLDFLFQVEVIQGC-FWEEFIDLGLQLaNFFAFANSCLNPVIYVFAGKLFRTKV 286
7tmA_CysLTR cd15921
cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G ...
19-318 4.36e-15

cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320587  Cd Length: 283  Bit Score: 74.07  E-value: 4.36e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  19 PITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVnflgTLS 98
Cdd:cd15921    4 PTAYILIFILGLTGNSISVYVFLSQYRSQTPVSVLMVNLAISDLLLVCTLPLRLTYYVLNSHWPFGDIACRII----LYV 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  99 MHVSMFVSLLILSWIAISRYATLMkkdstqettscyekifYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSvvE 178
Cdd:cd15921   80 LYVNMYSSIYFLTALSVFRYLALV----------------WPYLYLRVQTHSVAGIICGLIWILMGLASSPLLFAKS--K 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 179 ATEGEEKVCYNRQMELGAMLSQIAGLigTTFIGF--SFLVVLTSYYSFVSHLRKIrtctSITEKDLTYSSVKRHLLVIQI 256
Cdd:cd15921  142 QHDEGSTRCLELAHDAVDKLLLINYV--TLPVGFvvPFMTVIFCYIFIIKNLLKP----SPALGRTRPSRRKACALIIIS 215
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 343962599 257 LLV--VCFLPYSIFKPIFFVL-HQGKD-CQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15921  216 LGIflVCFLPYHIVRTIHLITeRQIKEsCGYILRVRKAAVITLCLAASNSCFDPLLYFFVGENFRS 281
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
18-318 4.43e-15

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216  Cd Length: 278  Bit Score: 74.03  E-value: 4.43e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGTL 97
Cdd:cd15088    3 MPSVFGCICVVGLVGNGIVLYVLVRCSKLRTAPDIFIFNLAVADLLFMLGMPFLIHQFAIDGQWYFGEVMCKIITALDAN 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 smhvSMFVSLLILSWIAISRYATLMKKDStqettscyekifyghlLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15088   83 ----NQFTSTYILTAMSVDRYLAVVHPIR----------------STKYRTRFVAKLVNVGLWAASFLSILPVWVYSSLI 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEkVCYnrqMELGAMLSQIAGLIGTTFIGFSF-LVVLTSYYSFVSHL--RKIRTCtSITEKDLTYSSVKRHLLVI 254
Cdd:cd15088  143 YFPDGTT-FCY---VSLPSPDDLYWFTIYHFILGFAVpLVVITVCYILILHRlaRGVAPG-NQSHGSSRTKRVTKMVILI 217
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 343962599 255 QILLVVCFLPYSIFKPIFFVLHQGKDCQQLNYLIEIkniltCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15088  218 VVVFIVCWLPFHVVQLVNLAMNRPTLAFEVAYFLSI-----CLGYANSCLNPFVYILVSENFRK 276
7tmA_GPR87 cd15969
G protein-coupled receptor 87, member of the class A family of seven-transmembrane G ...
18-318 5.37e-15

G protein-coupled receptor 87, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR87 acts as one of multiple receptors for lysophosphatidic acid (LPA). This orphan receptor has been shown to be overexpressed in several malignant tumors including lung squamous cell carcinoma and regulated by p53. GPR87 is phylogenetically closely related to the G(i) class of the P2Y family of purinergic G protein-coupled receptors. P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase.


Pssm-ID: 320635  Cd Length: 283  Bit Score: 73.67  E-value: 5.37e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLtKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15969    3 FPVLYLIIFIGSILLNGLAVWIFF-HIRNKTSFIFYLKNIVIADLLMTLTFPFKIIQDSGLGPWNFNFFLCRYTSVL--- 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLMKKdstqettscyekifYGHllKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSvV 177
Cdd:cd15969   79 -FYASMYTSIVFLGLISLDRYLKVVKP--------------FGD--SRMYSITFTKVLSACVWLIMAFLSLPNIILTN-G 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRK----IRTCTSITEKDltyssvKRHLLV 253
Cdd:cd15969  141 QPTEDNIHDCSKLKSPLGVKWHTAVSYINICIFVAVLVILIVCYISISRYIYKsskqFISSSSRTRKH------NQSIRV 214
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 343962599 254 IQILLVVCFLPYSIFKPIFFVLHQGK--DCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15969  215 VVAVFFVCFLPYHLCRIPFTFSQLDKilDCTIKTILYYCKEATLFLSACNVCLDPIIYFFMCRSFSQ 281
7tmA_BK-2 cd15381
bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled ...
16-318 6.67e-15

bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320503  Cd Length: 284  Bit Score: 73.65  E-value: 6.67e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLg 95
Cdd:cd15381    1 TFQPIYLWIIFVLGTIENAFVLIVFCLHKSSCTVAEIYLGNLAAADLLLVCCLPFWAINISNGFNWPFGEFLCKSVNAV- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 tlsMHVSMFVSLLILSWIAISRYATLMKKDStqettscyekifyghlLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd15381   80 ---IYMNLYSSIYFLMMVSIDRYLALVKTMS----------------SGRMRRPACAKLNCLIIWMFGLLMSTPMIVFRT 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCY------NRQMELGAMLSQIAGLIGTTFIGF-SFLVVLTSYYSFVSHLRKIRTCTSITekdltyssvk 248
Cdd:cd15381  141 VMYFPEYNITACVldypseGWHVALNILLNVVGFLIPLSIITFcSTQIIQVLRNNKMQKFKEIQTERKAT---------- 210
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 343962599 249 RHLLVIQILLVVCFLPYSI--FKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15381  211 VLVLAVLLMFFICWLPFHIftFLDTLHKLGLISGCRWEDILDIGTQIATFLAYSNSCLNPLLYVIVGKHFRK 282
7tmA_GPR171 cd15167
orphan G protein-coupled receptor 171, member of the class A family of seven-transmembrane G ...
19-317 7.79e-15

orphan G protein-coupled receptor 171, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR171 is phylogenetically related to the P2Y family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. A recent study has been reported that the peptide LENSSPQAPARRLLPP (BigLEN) activates GPR17 to regulate body weight in mice; however the biological role of the receptor remains unknown. GPR171 is a member of the class A G protein-coupled receptor superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A common feature of GPCR signaling is agonist-induced conformational changes in the receptors, which then activate the heterotrimeric G proteins. G-proteins regulate a variety of cellular functions including metabolic enzymes, ion channels, and transporters, among many others.


Pssm-ID: 320295  Cd Length: 282  Bit Score: 73.26  E-value: 7.79e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  19 PITYIFLCI--IGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgt 96
Cdd:cd15167    2 PFTYFYYLIflIGFIGSCFALWAFIQKRSSRKCINIYLINLLTADFLLTLALPVKIAVDLGIAPWKLKIFHCQVTACL-- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 lsMHVSMFVSLLILSWIAISRYatlmkkdsTQETTSCYekifyghlLKKFRQPNFARKLCVYIWVVVLGIIIPVILyysv 176
Cdd:cd15167   80 --IYINMYLSIIFLGFVSIDRY--------LQLTHSSK--------LYRIQEPGFAKMISAVVWTLVLFIMVPNMA---- 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKV---CYNRQMELGAMLSQIAGLIGTT-FIGFSfLVVLTSYYSFVSHLRKIRTCtsitEKDLTYSSVKRHLL 252
Cdd:cd15167  138 IPIKTIEEKPgvgCADFKTEFGRHWHVLTNFICMAiFLNFS-AIILISNFLVIRKLYRNKDS----EEYRNARQALVNIL 212
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 343962599 253 VIQILLVVCFLPYSIFKpIFFVLHQGK---DCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15167  213 LVTAGYVICFVPYHIVR-IPYTLSQSEvitDCSLKRSLFLAKESTLLLAVLNLCFDPILYFHLSKAFR 279
7tmA_P2Y14 cd15149
P2Y purinoceptor 14, member of the class A family of seven-transmembrane G protein-coupled ...
18-320 1.15e-14

P2Y purinoceptor 14, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y14 receptor is activated by UDP-sugars and belongs to the G(i) class of the P2Y family of purinergic G-protein coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-sugars (P2Y14). P2Y14 receptor has been reported to be involved in a diverse set of physiological responses in many epithelia as well as in immune and inflammatory cells.


Pssm-ID: 320277  Cd Length: 284  Bit Score: 72.96  E-value: 1.15e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKtSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15149    3 IPVFYSLVFIVGILLNGVNFWIFFYVPSNK-SFIVYLKNIVFADLLMSLTFPFKILSDVELGPWQLNVIVCRYSAVI--- 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLMKKDSTQETTSCyekifyghllkkfrqpNFARKLCVYIWVVVLGIIIPVILYYSVv 177
Cdd:cd15149   79 -FYLNMYVGIIFFGLIGFDRYYKIVKPLHTSFVQNV----------------GYSKALSVVVWMLMAVLSVPNIILTNQ- 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYS-----FVSHLRKIRTCTSITEKdltyssVKRHLL 252
Cdd:cd15149  141 SFHEANYTKCARLKSELGIQWHKASNYICVSIFWVVFLLLIIFYVAisrkiYKSNQKFRRNSTNMKAK------SSRNIF 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 253 VIQILLVVCFLPYSIFKPIFFVLHQGKD--CQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15149  215 SILFVFFVCFVPYHALRIPYTLSQTGADysCQSKTILYYMKEFTLLLSAANVCLDPIIYFFLCQPFREML 284
7tmA_GPR31 cd15199
G protein-coupled receptor 31, member of the class A family of seven-transmembrane G ...
17-317 1.45e-14

G protein-coupled receptor 31, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR31, also known as 12-(S)-HETE receptor, is a high-affinity receptor for 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid. Phylogenetic analysis showed that GPR31 and oxoeicosanoid receptor 1 (OXER1, GPR170) are the most closely related receptors to the hydroxycarboxylic acid receptor family (HCARs). GPR31, like OXER1, activates the ERK1/2 (MAPK3/MAPK1) pathway of intracellular signaling, but unlike the OXER1, does not cause increase in the cytosolic calcium level. GPR31 is also shown to activate NFkB. 12-(S)-HETE is a 12-lipoxygenase metabolite of arachidonic acid produced by mammalian platelets and tumor cells. It promotes tumor cells adhesion to endothelial cells and subendothelial matrix, which is a critical step for metastasis.


Pssm-ID: 320327  Cd Length: 278  Bit Score: 72.52  E-value: 1.45e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGT 96
Cdd:cd15199    2 AYASLLILEFGLGLPGNAIALWTFIFRLKVWKPYAVYLLNLVLADVLLLICLPFKAYFYLNGNRWSLGGGTCKALLFMLS 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 LSMHVSMfvslLILSWIAISRYAtlmkkdstqettscyeKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILyysV 176
Cdd:cd15199   82 LSRGVSI----AFLTAVALDRYF----------------RVVHPRGKKNSLSLQAAPYISFLVWLLLVGLTIPTLL---A 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVltsyYSFVSHLRKIRTCTSITEKDLTYSsvKRHLLVIQI 256
Cdd:cd15199  139 SQPKNFTECNSFSPKDDEDFSDTWQEAVFFLQFLLPFGLIV----FCTVRIIRRLKKRLRDVGKQPKLQ--RAMALVTSV 212
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 257 LLV--VCFLPYSIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15199  213 VVVfgFCFLPCFLARVLMLIFQNKESCNALNIAVHTYDVTMCLTYLNSVLDPIVYCFSSPTFR 275
7tmA_P2Y12-like cd15924
P2Y purinoceptors 12, 13, 14, and similar proteins, member of the class A family of ...
18-320 1.63e-14

P2Y purinoceptors 12, 13, 14, and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y12-like receptors as well as closely related orphan receptor, GPR87.


Pssm-ID: 320590  Cd Length: 284  Bit Score: 72.48  E-value: 1.63e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLtKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15924    3 LPVLYTIIFAAGILLNGLAAWIFF-HIPSSSSFIVYLKNTVVADLLMLLTFPFKILSDSGLGPWQLKLFVCRYTSVL--- 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLMK--KDSTQETTScyekifyghllkkfrqpnFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd15924   79 -FYLTMYTSIVFLGLISFDRYLKIVRpfMTSFLKSVS------------------FAKALSVLVWGLMFFLSLPNMILTN 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VvEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSY-----YSFVSHLRKIRTCTSITEKdltyssVKRH 250
Cdd:cd15924  140 Q-QPTEPTVKKCSALKSPLGLKWHEIVNYINQGIFWAVFLLMIVCYtaitkKVYRSYRRVFRSSSSRRKK------SNVS 212
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 251 LLVIQILLVVCFLPYSIFKpIFFVLHQGK---DCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15924  213 IFIVVAVFFVCFVPYHFCR-IPYTLSQTNkdfDCYAENILFY*KEATLFLSALNVCLDPIIYFFLCRSFRESL 284
7tmA_GPR33 cd15120
orphan receptor GPR33, member of the class A family of seven-transmembrane G protein-coupled ...
16-319 1.79e-14

orphan receptor GPR33, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor GPR33, an orphan member of the chemokine-like receptor family, was originally identified as a pseudogene in humans as well as in several apes and rodent species. Although the intact GPR33 allele is still present in a small fraction of the human population, the human GPR33 contains a premature stop codon. The amino acid sequence of GPR33 shares a high degree of sequence identity with the members of the chemokine and chemoattractant receptors that control leukocyte chemotaxis. The human GPR33 is expressed in spleen, lung, heart, kidney, pancreas, thymus, gonads, and leukocytes.


Pssm-ID: 320248  Cd Length: 282  Bit Score: 72.51  E-value: 1.79e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIaKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNflG 95
Cdd:cd15120    1 VLIAVALFVTFLVGLVVNGLYLWVLGFKM-RRTVNTLWFLHLILSNLIFTLILPFMAVHVLMDNHWAFGTVLCKVLN--S 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 TLSmhVSMFVSLLILSWIAISRYatlmkkdstqeTTSCYEKIFYGHllkkfRQPNFARKLCVYIWVVVLGIIIPvilYYS 175
Cdd:cd15120   78 TLS--VGMFTSVFLLTAISLDRY-----------LLTLHPVWSRQH-----RTNRWASAIVLGVWISAILLSIP---YLA 136
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEK--VCYN----------RQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYysfvshlrkIRTCTSITEKD 241
Cdd:cd15120  137 FRETRLDEKGktICQNnyalstnwesAEVQASRQWIHVAMFVFRFLLGFllPFLIITFCY---------VRMALKMKERG 207
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 242 LTYSSVKRHLLVIQIL-LVVCFLPYSifkpiffvLHQG----KDCQQLnyLIEIKNILT-CLASARSSTDPIIFLFLDKT 315
Cdd:cd15120  208 LARSSKPFKVMFTAVVsFFVCWLPYH--------LHSGlvltRGRPPS--LTDITLLLTvGTTCFNTCFTPVLYLFVGEN 277

                 ....
gi 343962599 316 FKKI 319
Cdd:cd15120  278 FKKV 281
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
15-323 2.26e-14

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 72.89  E-value: 2.26e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  15 SMALPITYIFLCIIGLFGNsLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMgIYFLKGFQWEYQSAQCRVVNFL 94
Cdd:PHA03087  40 STILIVVYSTIFFFGLVGN-IIVIYVLTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQ-IYYYILFQWSFGEFACKIVSGL 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  95 gtlsMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYY 174
Cdd:PHA03087 118 ----YYIGFYNSMNFITVMSVDRYIA----------------IVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVY 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 175 SVveATEGEEKVCYnRQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRTCTSitekdlTYSSVKRhLL 252
Cdd:PHA03087 178 TT--KKDHETLICC-MFYNNKTMNWKLFINFEINIIGMliPLTILLYCYSKILITLKGINKSKK------NKKAIKL-VL 247
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 253 VIQILLVVCFLPY--SIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIVYNL 323
Cdd:PHA03087 248 IIVILFVIFWLPFnvSVFVYSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKS 320
7tmA_P2Y10 cd15153
P2Y purinoceptor 10, member of the class A family of seven-transmembrane G protein-coupled ...
21-317 3.11e-14

P2Y purinoceptor 10, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y10 receptor is a G-protein coupled receptor that is activated by both sphingosine-1-phosphate (S1P) and lysophosphatidic acid (LPA). Phylogenetic analysis of the class A GPCRs shows that P2Y10 is grouped into the cluster comprising nucleotide and lipid receptors. Although the mouse P2Y10 was found to be expressed in brain, lung, reproductive organs, and skeletal muscle, the physiological function of this receptor is not yet known. S1P and LPA are bioactive lipid molecules that induce a variety of cellular responses through G proteins: adhesion, invasion, cell migration and proliferation, among many others.


Pssm-ID: 320281  Cd Length: 283  Bit Score: 71.75  E-value: 3.11e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  21 TYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPfMGIYFLKGFQWEYQSAQCRVVNFLGTLSMH 100
Cdd:cd15153    6 TYIIIFIPGLLANSAALWVLCRFISKKNKAIIFMINLAVADLAHVLSLP-LRIHYYIQHTWPFGRFLCLLCFYLKYLNMY 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 101 VSMFvsllILSWIAISRyatlmkkdstqettscyekifYGHLLKKFRQPNFARK----LCVYIWVVVLGIIIPVILYYSv 176
Cdd:cd15153   85 ASIC----FLTCISIQR---------------------CFFLLHPFKARDWKRRydvgISAAVWIVVGLACLPFPLLRS- 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 vEATEGEEKVCYN----RQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKdltySSVKRHLL 252
Cdd:cd15153  139 -KSLSNNNRSCFAdlgmKKLNFGAAIAMMTVAELFGFVIPLFIIAWCTWKTENSLRQRNKQQQSTSEK----QKALRMVR 213
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 343962599 253 VIQILLVVCFLPYSIFKPIFFVLHQG--KDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15153  214 MCAAVFFICFAPYHINFLFYLMVSESiiTNCEVSQVILQFHPISLCLASLNCCLDPILYYFMTSEFQ 280
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
18-318 4.60e-14

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320115  Cd Length: 278  Bit Score: 71.10  E-value: 4.60e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGfqWEYQSAQCRVVNFLGTL 97
Cdd:cd14984    3 LPVLYSLVFVLGLVGNSLVLLVLLYYKKLRSMTDVYLLNLALSDLLFVLTLPFWAVYAAHG--WVFGSFLCKLVSALYTI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 SMHVSMFvsllILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd14984   81 NFYSGIL----FLACISIDRYLAIVHAVSAL----------------RARTLLHGKLTCLAVWALALLLSLPEFIFSQVY 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EatEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRtctsitekdltysSVKRH----- 250
Cdd:cd14984  141 E--ENGSSRCSYIYPEDTATTWKTLLRLLQNILGFllPLLVMLFCYSRIIRTLLRAR-------------NHKKHralrl 205
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 343962599 251 LLVIQILLVVCFLPYSIFKPI-----FFVLhqGKDC---QQLNYLIEIKNILTCLasaRSSTDPIIFLFLDKTFKK 318
Cdd:cd14984  206 IFAVVVVFFLCWLPYNIVLLLdtlqrLGVI--IRSCelsKRLDYALQVTETLAFS---HCCLNPVLYAFVGEKFRK 276
7tmA_Kappa_opioid_R cd15091
opioid receptor subtype kappa, member of the class A family of seven-transmembrane G ...
22-318 8.03e-14

opioid receptor subtype kappa, member of the class A family of seven-transmembrane G protein-coupled receptors; The kappa-opioid receptor binds the opioid peptide dynorphin as the primary endogenous ligand. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320219  Cd Length: 282  Bit Score: 70.37  E-value: 8.03e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  22 YIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGfQWEYQSAQCRVVNFLGtlsmHV 101
Cdd:cd15091    7 YSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMN-SWPFGDVLCKIVISID----YY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 102 SMFVSLLILSWIAISRYatlmkkdstqettscyekIFYGHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEA 179
Cdd:cd15091   82 NMFTSIFTLTMMSVDRY------------------IAVCHPVKalDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVR 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 180 TEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQIL 257
Cdd:cd15091  144 EDVDSTECSLQFPDDDYSWWDTFMKICVFIFAFviPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAV 223
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 343962599 258 LVVCFLPYSifkpIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15091  224 FVVCWTPIH----IFILVEALGSVSHSTAAVSSYYFCIALGYTNSSLNPILYAFLDENFKR 280
7tmA_LTB4R1 cd15121
leukotriene B4 receptor subtype 1 (LTB4R1 or BLT1), member of the class A family of ...
27-311 8.14e-14

leukotriene B4 receptor subtype 1 (LTB4R1 or BLT1), member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the Gq-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320249  Cd Length: 278  Bit Score: 70.23  E-value: 8.14e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  27 IIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMgIYFLKGFQWEYQSAQCRVVNFLGTlsmhVSMFVS 106
Cdd:cd15121   12 ILGFPGNLFVVWSVLCRMKKRSVTCILVLNLALADAAVLLTAPFF-LHFLSGGGWEFGSVVCKLCHYVCG----VSMYAS 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 107 LLILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEaTEGEEKV 186
Cdd:cd15121   87 IFLITLMSMDRCLAVAKPFLSQ----------------KMRTKRSVRALLLAIWIVAFLLSLPMPFYRTVLK-KNINMKL 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 187 CYNRQMELGAMLSQiagLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRtctsitekdlTYSSVKRHLLVIQILLVVC--F 262
Cdd:cd15121  150 CIPYHPSVGHEAFQ---YLFETITGFllPFTAIVTCYSTIGRRLRSAR----------FRRKRRTNRLVVLIIATFAlfW 216
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 343962599 263 LPYSIFKPI---FFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLF 311
Cdd:cd15121  217 LPYHVVNLIqvaGALQNQAGNASVLKAAKLARPNVTALAFLSSSVNPVLYAF 268
7tmA_CysLTR1 cd15158
cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G ...
21-318 9.44e-14

cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320286  Cd Length: 285  Bit Score: 70.16  E-value: 9.44e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  21 TYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRvvnfLGTLSMH 100
Cdd:cd15158    6 LYSVITVFGLVGNGFALYVLIKTYRQKSAFHIYMLNLAVSDLLCVCTLPLRVVYYVHKGQWLFGDFLCR----ISSYALY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 101 VSMFVSLLILSWIAISRYATLmkkdstqettscyekIFYGHLLKKFRQpNFARKLCVYIWVVVLGIIIPVILYYSvvEAT 180
Cdd:cd15158   82 VNLYCSIYFMTAMSFTRFLAI---------------VFPVQNLNLVTV-KKARIVCVGIWIFVTLTSSPFLMSGS--HDT 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 181 EGEEKVCYNRQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKirtcTSITEKDLTYSSVKRHLLVIQILL 258
Cdd:cd15158  144 ETNKTKCFEPPQSNQQLTKLLVLNYISLVVGFiiPFLVILICYAMIIRTLLK----NTMKARKQQSSRKKAIRMIIIVLL 219
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 343962599 259 V--VCFLPYSIFKPI--FFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15158  220 AflVSFMPYHIQRTIhlHFLSRKDSTCEEVLYMQKSVVITLCLAAANCCFDPLLYFFSGENFRR 283
7tmA_P2Y3-like cd16001
P2Y purinoceptor 3-like proteins, member of the class A family of seven-transmembrane G ...
18-317 1.08e-13

P2Y purinoceptor 3-like proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y3-like proteins are an uncharacterized group that belongs to the G(i) class of a family of purinergic G-protein coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320667  Cd Length: 284  Bit Score: 70.17  E-value: 1.08e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd16001    3 LPVTYSVVFVLGLPLNGTVLWLSWCRTKRWTCSTIYLVNLAVADLLYVCSLPLLIVNYAMRDRWPFGDFLCKLVRFL--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLmkkdstqettsCYEkifyghlLKK--FRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd16001   80 -FYTNLYGSILFLTCISVHRFLGV-----------CYP-------IRSlaYRTRRLAVIGSAATWILVVLQLLPTLVYAR 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VveATEGEEKVCYNRQMELGAMLSQIAGLIgTTFIGF--SFLVVLTSYYSFVSHLRKiRTCTSITEKDLTYSSVkRHLLV 253
Cdd:cd16001  141 T--GSINNRTVCYDLTSPDNFGNYFPYGMV-LTVTGFliPFLIILLCYCLMIKSLIR-SEEAAGVGKAARAKSI-RTILL 215
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 343962599 254 IQILLVVCFLPYSIFKPIFFV--LHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFK 317
Cdd:cd16001  216 VCGLFALCFVPFHITRTIYLFvrVYLVQDCPLLQFVSLAYKIWRPLVSFNSCINPLLYFLSGDSNR 281
7tmA_SSTR5 cd15974
somatostatin receptor type 5, member of the class A family of seven-transmembrane G ...
16-318 2.23e-13

somatostatin receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR5 is coupled to inward rectifying K channels and phospholipase C, and plays critical roles in growth hormone and insulin secretion. SSTR5 acts as a negative regulator of PDX-1 (pancreatic and duodenal homeobox-1) expression, which is a conserved homeodomain-containing beta cell-specific transcription factor essentially involved in pancreatic development, among many other functions.


Pssm-ID: 320640  Cd Length: 277  Bit Score: 69.06  E-value: 2.23e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFqWEYQSAQCRVVNFLG 95
Cdd:cd15974    1 VLIPVIYLLVCAIGLSGNTLVIYVVLRYAKMKTVTNIYILNLAVADELFMLGLPFLATQNAISY-WPFGSFLCRLVMTVD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 TlsmhVSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVILY 173
Cdd:cd15974   80 G----VNQFTSIFCLTVMSIDRYLAVV------------------HPIKstKWRRPRVAKLINATVWTLSFLVVLPVIIF 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 174 YSVVEategEEKVCYNRQMELGAMLSQiAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHL 251
Cdd:cd15974  138 SDVQP----DLNTCNISWPEPVSVWST-AFIIYTAVLGFfgPLLVICLCYLLIVIKVKSSGLRVGSTKRRKSERKVTRMV 212
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 252 LVIQILLVVCFLPY---SIFKPIFFVlhqgkdcQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15974  213 VIIVVVFVFCWLPFymlNIVNLIVIL-------PEEPAFVGVYFFVVVLSYANSCANPILYGFLSDNFKQ 275
7tmA_P2Y8 cd15368
purinergic receptor P2Y8, member of the class A family of seven-transmembrane G ...
17-318 2.73e-13

purinergic receptor P2Y8, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y8 (or P2RY8) expression is often increased in leukemia patients, and it plays a role in the pathogenesis of acute leukemia. P2Y8 is phylogenetically closely related to the protease-activated receptors (PARs), which are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. Four different types of the protease-activated receptors have been identified (PAR1-4) and are predominantly expressed in platelets. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320490  Cd Length: 281  Bit Score: 69.03  E-value: 2.73e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVnflgT 96
Cdd:cd15368    2 ILPVVYSLVALISIPGNLFSLWLLCFHTKPKTPSIIFMINLSLTDLMLACFLPFQIVYHIQRNHWIFGKPLCNVV----T 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 LSMHVSMFVSLLILSWIAISRYAtlmkkdstqettscyeKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSV 176
Cdd:cd15368   78 VLFYANMYSSILTMTCISIERYL----------------GVVYPMRSMRWRKKRYAVAACIGMWLLVLTALSPLERTDLT 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 177 VEATEGEEKVCYN-RQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIq 255
Cdd:cd15368  142 YYVKELNITTCFDvLKWTMLPNIAAWAAFLFTLFILLFLIPFIITVYCYVLIILKLVQTSERYGREQKRRAIYLALIVL- 220
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 256 ILLVVCFLPYSIFKPIFFV--LHQGKdcqqlNYLIEIKNILtCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15368  221 LVFITCFAPNNFILLAHMVsrLFYGK-----SLYHAYKLTL-SLSCLNSCLDPFIYYFASKEFRK 279
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
19-318 2.80e-13

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224  Cd Length: 284  Bit Score: 68.86  E-value: 2.80e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  19 PITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLL---VCsaMPFMGIYFLKGfQWEYQSAQCRVVNFLg 95
Cdd:cd15096    4 PVIFGLIFIVGLIGNSLVILVVLSNQQMRSTTNILILNLAVADLLfvvFC--VPFTATDYVLP-TWPFGDVWCKIVQYL- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  96 tlsMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd15096   80 ---VYVTAYASVYTLVLMSLDRYLA----------------VVHPITSMSIRTERNTLIAIVGIWIVILVANIPVLFLHG 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYnrqmelgAMLSQIAGLIG----TTFIGFSFLVVLTS----YYSFVSHLRKIRT--CTSITEKDLTYS 245
Cdd:cd15096  141 VVSYGFSSEAYSY-------CTFLTEVGTAAqtffTSFFLFSYLIPLTLicvlYMLMLRRLRRQKSpgGRRSAESQRGKR 213
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 343962599 246 SVKRHLLVIQILLVVCFLPYSIfkpIFFVLHQGKDCQQLNYLIeIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15096  214 RVTRLVVVVVVVFAICWLPIHI---ILLLKYYGVLPETVLYVV-IQILSNCLAYGNSCVNPILYAFLSQNFRK 282
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
18-318 2.84e-13

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320  Cd Length: 285  Bit Score: 69.00  E-value: 2.84e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGTL 97
Cdd:cd15192    3 IPTVYSIIFVIGIFGNSLVVIVIYCYMKLKTVANIFLLNLALADLCFLITLPLWAAYTAMGYHWPFGNFLCKISSTLVSF 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 SMHVSMFvsllILSWIAISRYATLMkkdstqettscyekifygHLLKK--FRQPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd15192   83 NLYASVF----LLTCLSIDRYLAIV------------------HPMKSriRRTLVVARVTCIVIWLLAGVASLPAIIFRD 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVC----YNRQMELGAMLSQIAGLIGttFIgFSFLVVLTSYYSFVSHLRKIRTCTSITEKDltySSVKRHL 251
Cdd:cd15192  141 VFFYENWNKTVCafhyPNQNKQLLVGMGLMKNLLG--FL-IPFLIILTCYTLIGKTLKQAYQIQRSKSRN---DEIFKMI 214
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 343962599 252 LVIQILLVVCFLPYSIFK--PIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15192  215 MAVVLFFFFCWIPHQVFTflDVLIQLKVIQNCHILEIVDTAMPFTICIAYFNSCLNPILYGFVGKNFRK 283
7tmA_Mu_opioid_R cd15090
opioid receptor subtype mu, member of the class A family of seven-transmembrane G ...
22-318 3.55e-13

opioid receptor subtype mu, member of the class A family of seven-transmembrane G protein-coupled receptors; The mu-opioid receptor binds endogenous opioids such as beta-endorphin and endomorphin. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320218  Cd Length: 279  Bit Score: 68.48  E-value: 3.55e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  22 YIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGfQWEYQSAQCRVVNFLGtlsmHV 101
Cdd:cd15090    7 YSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMG-TWPFGNILCKIVISID----YY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 102 SMFVSLLILSWIAISRYatlmkkdstqettscyekIFYGHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVIlyysvVEA 179
Cdd:cd15090   82 NMFTSIFTLCTMSVDRY------------------IAVCHPVKalDFRTPRNAKIVNVCNWILSSAIGLPVM-----FMA 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 180 TEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSF----LVVLTSYYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQ 255
Cdd:cd15090  139 TTKYRQGSIDCTLTFSHPSWYWENLLKICVFIFAFimpvLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVV 218
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 343962599 256 ILLVVCFLP---YSIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLasarsstDPIIFLFLDKTFKK 318
Cdd:cd15090  219 AVFIVCWTPihiYVIIKALVTIPETTFQTVSWHFCIALGYTNSCL-------NPVLYAFLDENFKR 277
7tmA_P2Y1-like cd15967
P2Y purinoceptor 1-like; P2Y1-like is an uncharacterized group that is phylogenetically ...
18-317 4.16e-13

P2Y purinoceptor 1-like; P2Y1-like is an uncharacterized group that is phylogenetically related to a family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320633  Cd Length: 281  Bit Score: 68.56  E-value: 4.16e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15967    3 LPPVYILVFVVGLVGNVWGLKSLLANWKKLGNINVFVLNLGLADLLYLLTLPFLVVYYLKGRKWIFGQVFCKITRFC--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLKKFR--QPNFARKLCVYIWVVVLGIIIPVILYYS 175
Cdd:cd15967   80 -FNLNLYGSIGFLTCISVYRYLAIV------------------HPMRVMGriTTTHSVVISALVWLLVVIQSLPDLFFSK 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYNRQMElgamlSQIAGLIGTTFIGF--SFLVVLTSYysfvSHLRKIRTCTSITEKDLTYSSVKrhLLV 253
Cdd:cd15967  141 TNSNGTKCFDTTFNDYLE-----SYLTYSLGWTVTGFviPLLIILGCY----GHVVVVLCRNNNVDKGLKQRCLK--LVI 209
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 343962599 254 IQILLV-VCFLPYSIFKPIFF---VLHQGKDCQQLNYLIEIKNILT-CLASARSSTDPIIFLFLDKTFK 317
Cdd:cd15967  210 ILIVLFsVCYIPYHVFRNLNLlsrILQKQGSCTQWFRGIYIAHQVSrGLVCLNSALNPLVYLMGSEDIL 278
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
16-318 4.69e-13

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124  Cd Length: 296  Bit Score: 68.39  E-value: 4.69e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  16 MALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLV-CSAMPF-MGIYFLKGfqWEYQSAQCRVVNF 93
Cdd:cd14993    1 IVLIVLYVVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVADLLVsLFCMPLtLLENVYRP--WVFGEVLCKAVPY 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  94 LgtlsMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILY 173
Cdd:cd14993   79 L----QGVSVSASVLTLVAISIDRYLA----------------ICYPLKARRVSTKRRARIIIVAIWVIAIIIMLPLLVV 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 174 YSVVEATEGEEK---VCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTSYYSFVShlRKIRTCTSITEKDLTYSSVKRH 250
Cdd:cd14993  139 YELEEIISSEPGtitIYICTEDWPSPELRKAYNVALFVVLYVLPLLIISVAYSLIG--RRLWRRKPPGDRGSANSTSSRR 216
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 343962599 251 LL-----VIQILLVV------CFLPYSIFKPIFFVLHQGKDCQQLNYLIeIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd14993  217 ILrskkkVARMLIVVvvlfalSWLPYYVLSILLDFGPLSSEESDENFLL-ILPFAQLLGYSNSAINPIIYCFMSKKFRR 294
7tmA_LTB4R cd14975
leukotriene B4 receptors, member of the class A family of seven-transmembrane G ...
27-311 1.04e-12

leukotriene B4 receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the G(q)-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320106  Cd Length: 278  Bit Score: 67.12  E-value: 1.04e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  27 IIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMgIYFLKGFQWEYQSAQCRVVNFLgtlsMHVSMFVS 106
Cdd:cd14975   12 AIGLPGNSFVIWSILIKVKQRSVTMLLVLNLALADLAVLLTLPVW-IYFLATGTWDFGLAACKGCVYV----CAVSMYAS 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 107 LLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEATEGEekV 186
Cdd:cd14975   87 VFLITLMSLERFLA----------------VSRPFVSQGWRAKALAHKVLAIIWLLAVLLATPVIAFRHVEETVENG--M 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 187 CYNRQMELGamlSQIAGLIGTTFIGFS--FLVVLTSYYSFVSHLRKIRtctsitekdltYSSVKRHLLVIQILLV---VC 261
Cdd:cd14975  149 CKYRHYSDG---QLVFHLLLETVVGFAvpFTAVVLCYSCLLRRLRRRR-----------FRRRRRTGRLIASVVVafaAC 214
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 343962599 262 FLPYSIFKPIFFVLHQGKDCQQLNYLIE----IKNILTCLASARSSTDPIIFLF 311
Cdd:cd14975  215 WLPYHVGNLLEVVSELIGGSKMAGTLGKvaeaGRPIAGALAFLSSSINPLLYAF 268
7tmA_C3aR cd15115
complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of ...
20-318 1.10e-12

complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320243  Cd Length: 265  Bit Score: 67.10  E-value: 1.10e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  20 ITYIFLCIIGLFGNSLSQWIFLTKIaKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGTLsm 99
Cdd:cd15115    5 VVLSLTFLLGVPGNGLVIWVAGLKM-KRTVNTIWFLNLAVADLLCCLSLPFSIAHLLLNGHWPYGRFLCKLLPSIIVL-- 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 100 hvSMFVSLLILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVea 179
Cdd:cd15115   82 --NMFASVFTLTAISLDRFLLVIKPVWAQ----------------NHRSVLLACLLCGCIWILALLLCLPVFIYRTTV-- 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 180 TEGEEKVCynrqmelgamlsqiagligttfiGFSFLVVLT---SYYSFVSHLRKIRTCTSITEKDLTYSSVK-------R 249
Cdd:cd15115  142 TDGNHTRC-----------------------GYDFLVAITitrAVFGFLLPLLIIAACYSFIAFRMQRGRFAksqsktfR 198
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 343962599 250 HLLVIQILLVVCFLPYSIFKpiffVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15115  199 VIIAVVVAFFVCWAPYHIIG----ILSLYGDPPLSKVLMSWDHLSIALAYANSCLNPVLYVFMGKDFKK 263
7tmA_SSTR3 cd15972
somatostatin receptor type 3, member of the class A family of seven-transmembrane G ...
18-318 1.34e-12

somatostatin receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR3 is coupled to inward rectifying potassium channels. SSTR3 plays critical roles in growth hormone secretion, endothelial cell cycle arrest and apoptosis. Furthermore, SSTR3 is expressed in the normal human pituitary and in nearly half of pituitary growth hormone adenomas.


Pssm-ID: 320638  Cd Length: 279  Bit Score: 66.75  E-value: 1.34e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFqWEYQSAQCRVVNFLGTl 97
Cdd:cd15972    3 IPLVYLVVCVVGLGGNTLVIYVVLRYSASESVTNIYILNLALADELFMLGLPFLAAQNALSY-WPFGSFMCRLVMTVDA- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 smhVSMFVSLLILSWIAISRYATLMKKDSTQettscyekifyghllkKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVV 177
Cdd:cd15972   81 ---INQFTSIFCLTVMSVDRYLAVVHPIRSS----------------KWRKPPVAKTVNATVWALSFLVVLPVVIFSGVP 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATegeeKVCyNRQMELGAMLSQIAGLIGTTFIGF--SFLVVLTSYYSFVSHLRKI--RTCTSITEKDLTYSSVKRHLLV 253
Cdd:cd15972  142 GGM----GTC-HIAWPEPAQVWRAGFIIYTATLGFfcPLLVICLCYLLIVVKVRSSgrRVRATSTKRRGSERKVTRMVVI 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 343962599 254 IQILLVVCFLPYSIFKPIFFVLHQGKDCQqlnyLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15972  217 VVAAFVLCWLPFYALNIVNLVCPLPEEPS----LFGLYFFVVVLSYANSCANPIIYGFLSDNFKQ 277
7tmA_P2Y6_P2Y3-like cd15968
P2Y purinoceptors 6 and 3, and similar proteins, member of the class A family of ...
18-316 2.13e-12

P2Y purinoceptors 6 and 3, and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes P2Y receptor 6 (P2Y6), P2Y3, and P2Y3-like proteins. These receptors belong to the G(i) class of a family of purinergic G-protein coupled receptors. In the CNS, P2Y6 plays a role in microglia activation and phagocytosis, and is involved in the secretion of interleukin from monocytes and macrophages in the immune system. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320634  Cd Length: 285  Bit Score: 66.34  E-value: 2.13e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15968    3 LPICYSFVFLLGLPLNSVVLTRCCRHTKAWTRTAIYMVNLALADLLYALSLPLLIYNYAMRDRWLFGDFMCRLVRFL--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYAtlmkkdstqettscyeKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVv 177
Cdd:cd15968   80 -FYFNLYGSILFLTCISVHRYL----------------GICHPMRPWHKETRRAAWLTCVLVWILVFAQTLPILIFART- 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 eATEGEEKVCYNRQMELGAMLSQIAGLIgTTFIGF--SFLVVLTSYYSFVSHLrkirtCTSITEKDLTYSSVK----RHL 251
Cdd:cd15968  142 -GIIRNRTVCYDLAPPALFPHYVPYGMA-LTVSGFllPFSIILWCYCLVVRTL-----CRTLGPAEPPAQARRrksiRTI 214
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 343962599 252 LVIQILLVVCFLPYSIFKPIFFVL--HQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTF 316
Cdd:cd15968  215 VTVTLLFALCFLPFHITRTIYLAVrvTPGVPCHVLEAVAACYKITRPLASANSVLNPLLYFLTKKKF 281
7tmA_SSTR2 cd15971
somatostatin receptor type 2, member of the class A family of seven-transmembrane G ...
18-318 2.45e-12

somatostatin receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin, a polypeptide hormone that regulates a wide variety of physiological such as neurotransmission, endocrine secretion, cell proliferation, and smooth muscle contractility. SSTRs are composed of five distinct subtypes (SSTR1-5) which are encoded by separate genes on different chromosomes. SSTR2 plays critical roles in growth hormone secretion, glucagon secretion, and immune responses. SSTR2 is expressed in the normal human pituitary and in nearly all pituitary growth hormone adenomas.


Pssm-ID: 320637  Cd Length: 279  Bit Score: 66.02  E-value: 2.45e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKgFQWEYQSAQCRVVNFLGTL 97
Cdd:cd15971    3 LTFIYFVVCIIGLCGNTLVIYVILRYAKMKTVTNIYILNLAIADELFMLGLPFLAIQVAL-VHWPFGKAICRVVMTVDGI 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 smhvSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLK--KFRQPNFARKLCVYIWVVVLGIIIPvILYYS 175
Cdd:cd15971   82 ----NQFTSIFCLTVMSIDRYLAVV------------------HPIKsaKWRKPRTAKMINMAVWGVSLLVILP-IMIYA 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 176 VVEATEGEEKVCYNRQMELGAMLSqiaGLIGTTFIgFSFLVVLT----SYYSFVSHLRKIRTCTSITEKDLTYSSVKRHL 251
Cdd:cd15971  139 GVQTKHGRSSCTIIWPGESSAWYT---GFIIYTFI-LGFFVPLTiiclCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMV 214
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 343962599 252 LVIQILLVVCFLPYSIFKpiffVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15971  215 SIVVAVFVFCWLPFYIFN----VSSVSVSISPTPGLKGMFDFVVVLSYANSCANPILYAFLSDNFKK 277
7tmA_GPR132_G2A cd15364
proton-sensing G protein-coupled receptor 132, member of the class A family of ...
18-311 2.91e-12

proton-sensing G protein-coupled receptor 132, member of the class A family of seven-transmembrane G protein-coupled receptors; The G2 accumulation receptor (G2A, also known as GPR132) is a member of the proton-sensing G-protein-coupled receptor (GPCR) family which also includes the T cell death associated gene-8 (TDAG8, GPR65) receptor, ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4). Proton-sensing G-protein coupled receptors sense pH of 7.6 to 6.0 and mediates a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. G2A was originally identified as a stress-inducible receptor that causes the cell cycle arrest at G2/M phase when serum is deprived. Lysophosphatidylcholine was identified as a ligand for G2A, and whose overexpression was shown to induce cell proliferation, oncogenic transformation, and apoptosis.


Pssm-ID: 320486  Cd Length: 279  Bit Score: 65.96  E-value: 2.91e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  18 LPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLgtl 97
Cdd:cd15364    3 LVVVYSVVFALGFPANCLTLWLTLLQVRRKNVLAVYLFSLSLCELLYLGTLPLWTIYVSNNHKWPWGSLACKITGYI--- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  98 sMHVSMFVSLLILSWIAISRYATlmkkdstqettscyekIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVilyYSVV 177
Cdd:cd15364   80 -FFCNIYISILLLCCISIDRFVA----------------VVYALESRGRRRQRIAAFISFLIFIVVGLVHSPV---FIMR 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 178 EATEGEEKVCYnrqmELGAMLSQIAGLIGTTF-IGFSF---LVVLTSYYSFvshlRKIRTCTSITEKDltYSSVKRHLLV 253
Cdd:cd15364  140 EGQTEGSHTCF----ETLQMDTQVAGFYYARFcIGFAIplaILIFTNYRIF----RSIQTSTSLTPHQ--KAKVKYLAIA 209
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 343962599 254 IQILLVVCFLPYSI---FKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLF 311
Cdd:cd15364  210 VIVIFLICFAPYHLvllVRAIAFSLYPNGMCGFEERIYTPSVIFLCLSTVNSVADPIIYVL 270
7tmA_GPR1 cd15119
G protein-coupled receptor 1 for chemerin, member of the class A family of seven-transmembrane ...
20-320 3.03e-12

G protein-coupled receptor 1 for chemerin, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 1 (GPR1) belongs to the class A of the seven transmembrane domain receptors. This is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1. GPR1 is most closely related to another chemerin receptor CMKLR1. In an in-vitro study, GPR1 has been shown to act as a co-receptor to allow replication of HIV viruses.


Pssm-ID: 320247  Cd Length: 278  Bit Score: 65.92  E-value: 3.03e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  20 ITYIFLCIIGLFGNSLSQWIFLTKIaKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGTLsm 99
Cdd:cd15119    5 VIYIVAFVLGVPGNAIVIWVTGFKW-KKTVNTLWFLNLAIADFVFVLFLPLHITYVALDFHWPFGVWLCKINSFVAVL-- 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 100 hvSMFVSLLILSWIAISRYATLMkkdstqettscyekifYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEA 179
Cdd:cd15119   82 --NMFASVLFLTVISLDRYISLA----------------HPVWSHRYRTLKSALILCGIVWLSAAAISGPALYFRDTMEL 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 180 TEGeEKVCYNRQM----ELGAMLSQIAGLIgTTFIG--FSFLVVLTSYYSFVSHLRKIRTCTSitekdltySSVKRHLLV 253
Cdd:cd15119  144 SIN-VTICFNNFHkhdgDLIVMRHTILVWV-RFFFGflFPLLTMVVCYSLLAIKVKRRTLLIS--------SKFFWTISA 213
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 343962599 254 IQILLVVCFLPYSIFKPIFFVLHQGkdcQQLNYLIEIK-NILTCLASARSSTDPIIFLFLDKTFKKIV 320
Cdd:cd15119  214 VIVAFFVCWTPYHIFSILELSIHHS---SYLHNVLRAGiPLATSLAFINSCLNPILYVLIGKKFKAHL 278
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
22-318 3.75e-12

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331  Cd Length: 293  Bit Score: 65.70  E-value: 3.75e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  22 YIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCS-AMPFMGIYFLKgFQWEYQSAQCRVVNFLgtlsMH 100
Cdd:cd15203    7 YGLIIVLGVVGNLLVIYVVLRNKSMQTVTNIFILNLAVSDLLLCLvSLPFTLIYTLT-KNWPFGSILCKLVPSL----QG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 101 VSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEAT 180
Cdd:cd15203   82 VSIFVSTLTLTAIAIDRYQLIV------------------YPTRPRMSKRHALLIIALIWILSLLLSLPLAIFQELSDVP 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 181 EGEEKVCYnRQMELGAMLSQIAGLIGTTFIGFSFLVVLT----SYYSFVSHLRKiRTCTSITEKDLTYSSVK-------- 248
Cdd:cd15203  144 IEILPYCG-YFCTESWPSSSSRLIYTISVLVLQFVIPLLiisfCYFRISLKLRK-RVKKKRGKRTLSSRRRRselrrkrr 221
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 343962599 249 --RHLLVIQILLVVCFLPYSIFKPIFFVLHQGKDCQQLNYLIEikniLTCLASARSST--DPIIFLFLDKTFKK 318
Cdd:cd15203  222 tnRLLIAMVVVFAVCWLPLNLFNLLRDFEPLPQIDGRHFYLIF----LICHLIAMSSAcvNPLLYGWLNDNFRK 291
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
17-188 4.32e-12

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320306  Cd Length: 279  Bit Score: 65.37  E-value: 4.32e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  17 ALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGfqWEYQSAQCRVVNFLgt 96
Cdd:cd15178    2 ALCVIYVLVFLLSLPGNSLVVLVILYNRRSRSSTDVYLLHLAIADLLFALTLPFWAVSVVKG--WIFGTFMCKLVSLL-- 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  97 lsMHVSMFVSLLILSWIAISRYATLMKkdSTQETTScyekifyGHLLKKFrqpnfarkLCVYIWVVVLGIIIPVILYYSV 176
Cdd:cd15178   78 --QEANFYSGILLLACISVDRYLAIVH--ATRALTQ-------KRHLVKF--------VCAGVWLLSLLLSLPALLNRDA 138
                        170
                 ....*....|..
gi 343962599 177 VEATEGEEKVCY 188
Cdd:cd15178  139 FKPPNSGRTVCY 150
7tmA_SSTR4 cd15973
somatostatin receptor type 4, member of the class A family of seven-transmembrane G ...
22-318 4.70e-12

somatostatin receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR4 plays a critical role in mediating inflammation. Unlike other SSTRs, SSTR4 subtype is not detected in all pituitary adenomas while it is expressed in the normal human pituitary.


Pssm-ID: 320639  Cd Length: 274  Bit Score: 65.26  E-value: 4.70e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599  22 YIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGfQWEYQSAQCRVVnflgtLSMH- 100
Cdd:cd15973    7 YALVCLVGLIGNSMVIFVILRYAKMKTATNIYILNLAIADELFMLSVPFLAASAALQ-HWPFGSAMCRTV-----LSVDg 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 101 VSMFVSLLILSWIAISRYATLMkkdstqettscyekifygHLLK--KFRQPNFARKLCVYIWVVVLGIIIPVILYYSVve 178
Cdd:cd15973   81 INMFTSVFCLTVLSVDRYIAVV------------------HPLRaaRYRRPTVAKMINICVWILSLLVISPIIIFADT-- 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 343962599 179 ATEGEEKVCYNRQMELGAMlsQIAGLIGTTFIGFSFLVVLTS--YYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQI 256
Cdd:cd15973  141 ATRKGQAVACNLIWPHPAW--SAAFVIYTFLLGFLLPVLAIGlcYILIIGKMRAVALKAGWQQRRKSEKKITRMVLMVVT 218
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 343962599 257 LLVVCFLPYSIFKPIFFVLHQGKdcqqlnylIEIKNILTCLASARSSTDPIIFLFLDKTFKK 318
Cdd:cd15973  219 VFVICWMPFYVVQLLNLFLPRLD--------ATVNHASLILSYANSCANPILYGFLSDNFRR 272
7tmA_P2Y12 cd15150
P2Y purinoceptor 12, member of the class A family of seven-transmembrane G protein-coupled ...
19-318 4.80e-12

P2Y purinoceptor 12, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y12 receptor (P2Y12R) is found predominantly on the surface of blood platelets and is activated by adenosine diphosphate (ADP). P2Y12R plays an important role in the regulation of blood clotting and belongs to the G(i) class of the P2Y family of purinergic G protein-coupled receptors. P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors