NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|33859484|ref|NP_032589|]
View 

DNA replication licensing factor MCM3 [Mus musculus]

Protein Classification

MCM_N and AAA domain-containing protein (domain architecture ID 12168656)

MCM_N and AAA domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCM smart00350
minichromosome maintenance proteins;
109-654 0e+00

minichromosome maintenance proteins;


:

Pssm-ID: 214631  Cd Length: 509  Bit Score: 728.67  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    109 KHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRS---VHYCPATKKTIERRYSDLTTLVAFPSSSVYPTkdeennPLE 185
Cdd:smart00350   1 KPSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRAsftCEKCGATLGPEIQSGRETEPTVCPPRECQSPT------PFS 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    186 TEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLP-GKKGCYTSGT--FRTVLIA 262
Cdd:smart00350  75 LNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVPyGFKLNTVKGLpvFATYIEA 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    263 CNVK----QMSKDIQP----AFSADDIAKIKKFSKtrSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSH 334
Cdd:smart00350 155 NHVRkldyKRSFEDSSfsvqSLSDEEEEEIRKLSK--DPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMK 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    335 IRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKM 414
Cdd:smart00350 233 IRGDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKM 312
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    415 SDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQD 494
Cdd:smart00350 313 DDSDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERD 392
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    495 REISDHVLRMHQYRAPGEQDGDalplgssvdilatddpdftqddqqdtriyekhdsllhgtkkkkEKMVSAAFMKKYIHV 574
Cdd:smart00350 393 RELAKHVVDLHRYSHPEEDEAF-------------------------------------------EPPLSQEKLRKYIAY 429
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    575 AK-IIKPTLTQESAAYIAEEYSRLRSQDSmSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAY 653
Cdd:smart00350 430 AReKIKPKLSEEAADKLVKAYVDLRKEDS-QTESRSSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRESI 508

                   .
gi 33859484    654 F 654
Cdd:smart00350 509 I 509
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal domain of MCM proteins.
19-104 1.12e-14

MCM N-terminal domain; This family contains the N-terminal domain of MCM proteins.


:

Pssm-ID: 317013  Cd Length: 92  Bit Score: 72.28  E-value: 1.12e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    19 YLDFLD---DEEDQGIYQNKVRELISDNQYRLIVSVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQY 95
Cdd:pfam14551   1 FKDFLRefrEEDGEFKYRDQLREMAEREQRSLEVDLDDLREFDPELAEALLENPYEYLPLFEEALKEVVLELFPEYADEE 80
                          90
                  ....*....|..
gi 33859484    96 E---EFYIGLEG 104
Cdd:pfam14551  81 ElerEFQVRFYN 92
 
Name Accession Description Interval E-value
MCM smart00350
minichromosome maintenance proteins;
109-654 0e+00

minichromosome maintenance proteins;


Pssm-ID: 214631  Cd Length: 509  Bit Score: 728.67  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    109 KHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRS---VHYCPATKKTIERRYSDLTTLVAFPSSSVYPTkdeennPLE 185
Cdd:smart00350   1 KPSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRAsftCEKCGATLGPEIQSGRETEPTVCPPRECQSPT------PFS 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    186 TEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLP-GKKGCYTSGT--FRTVLIA 262
Cdd:smart00350  75 LNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVPyGFKLNTVKGLpvFATYIEA 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    263 CNVK----QMSKDIQP----AFSADDIAKIKKFSKtrSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSH 334
Cdd:smart00350 155 NHVRkldyKRSFEDSSfsvqSLSDEEEEEIRKLSK--DPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMK 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    335 IRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKM 414
Cdd:smart00350 233 IRGDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKM 312
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    415 SDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQD 494
Cdd:smart00350 313 DDSDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERD 392
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    495 REISDHVLRMHQYRAPGEQDGDalplgssvdilatddpdftqddqqdtriyekhdsllhgtkkkkEKMVSAAFMKKYIHV 574
Cdd:smart00350 393 RELAKHVVDLHRYSHPEEDEAF-------------------------------------------EPPLSQEKLRKYIAY 429
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    575 AK-IIKPTLTQESAAYIAEEYSRLRSQDSmSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAY 653
Cdd:smart00350 430 AReKIKPKLSEEAADKLVKAYVDLRKEDS-QTESRSSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRESI 508

                   .
gi 33859484    654 F 654
Cdd:smart00350 509 I 509
Mcm2 COG1241
DNA replicative helicase MCM subunit Mcm2, Cdc46/Mcm family [Replication, recombination and ...
17-662 0e+00

DNA replicative helicase MCM subunit Mcm2, Cdc46/Mcm family [Replication, recombination and repair];


Pssm-ID: 224162  Cd Length: 682  Bit Score: 581.23  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  17 RDYLDFLDDEEDQGIYQNKVrELISDNQYRLIVSVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYE 96
Cdd:COG1241   4 AELFRLRFKWEDILEYAENI-ILDKIINRSLEVDLSDLEEYDPELAGLLLENPEEIIPLFEKALDEIALLLFPEVDRSLK 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  97 EFYIGLEGSFgsKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLvafPSSSVYPT 176
Cdd:COG1241  83 KIHVRFKNLP--NRLSIRELRSEHIGKLVSVEGIVTRASEVRPRLKKAVFECPKCGREVEVEQSEFRVE---PPRECENC 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 177 KDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLPGKKGCY--TSG 254
Cdd:COG1241 158 GKFGKGPLKLVPRKSEFIDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDRVKITGVVRIVPSRSLSGrrKGP 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 255 TFRTVLIACNVKQMSKDIQPAFSADDIAKIKKFSKtrSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSH 334
Cdd:COG1241 238 VFEIYLEANSVEKLDKREEVEITEEDEEEIKELAK--RPDIYDILIKSIAPSIYGHEDVKKAILLQLFGGVKKNLPDGTR 315
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 335 IRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKM 414
Cdd:COG1241 316 IRGDIHILLVGDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGALVLADGGVCCIDEFDKM 395
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 415 SDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQD 494
Cdd:COG1241 396 NEEDRVAIHEAMEQQTISIAKAGITATLNARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLKDDPDEEKD 475
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 495 REISDHVLRMHQYRAPGEQDGDalplgSSVDILATDDPDftqddqqdtriyekhdsllhgtkkkkekmvsaaFMKKYIHV 574
Cdd:COG1241 476 EEIAEHILDKHRGEEPEETISL-----DGVDEVEERDFE---------------------------------LLRKYISY 517
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 575 AK-IIKPTLTQESAAYIAEEYSRLRsQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAY 653
Cdd:COG1241 518 ARkNVTPVLTEEAREELEDYYVEMR-KKSALVEEKRTIPITARQLESIIRLAEAHAKMRLSDVVEEEDVDEAIRLVDFSL 596

                ....*....
gi 33859484 654 FKKVLEKEK 662
Cdd:COG1241 597 KTVAVDPEK 605
MCM pfam00493
MCM2/3/5 family;
280-650 4.65e-159

MCM2/3/5 family;


Pssm-ID: 306894  Cd Length: 326  Bit Score: 469.70  E-value: 4.65e-159
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   280 DIAKIKKFSKtrSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSHIRGDINILLIGDPSVAKSQLLRYVL 359
Cdd:pfam00493   1 DEEEIKELAK--DPDIYEKLANSIAPSIYGHEDVKKAILLQLFGGVKKITPDGHRLRGDINVLLVGDPGTAKSQLLKYVE 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   360 CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIH 439
Cdd:pfam00493  79 KIAPRAVYTSGKGSSAAGLTAAVVRDPVTGEFVLEAGALVLADGGVCCIDEFDKMNESDRVALHEAMEQQTISIAKAGIV 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   440 ARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHQYRAPGEQDGDALP 519
Cdd:pfam00493 159 ATLNARCSVLAAANPIFGRYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEEKDERLAKHIVDLHRNSVEESIEGEMVE 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   520 LgssvdilatdDPDftqddqqdtriyekhdsllhgtkkkkekmvsaaFMKKYIHVAKIIKPTLTQESAAYIAEEYSRLRs 599
Cdd:pfam00493 239 I----------DPE---------------------------------LLRKYIAYARNIKPKLSDEAREKLVNYYVELR- 274
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 33859484   600 QDSMSSDtarTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQ 650
Cdd:pfam00493 275 KESQSTG---SIPITVRQLESLIRLSEAHAKLRLSEVVTEEDVEEAIRLIK 322
PTZ00111 PTZ00111
DNA replication licensing factor MCM4; Provisional
113-659 2.41e-78

DNA replication licensing factor MCM4; Provisional


Pssm-ID: 173403  Cd Length: 915  Bit Score: 273.79  E-value: 2.41e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  113 PRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVafpssSVYPTKDEENNPL-------- 184
Cdd:PTZ00111 218 VGNLEPSMADSLVQFSGTVVRQTWIVPEITMACFRCRGQKKIGLNDYQPCTCEH-----YEYVIQGEVNEPLlcnecnsk 292
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  185 ---ETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDK--------------------VKPGDRIQVVG-- 239
Cdd:PTZ00111 293 ytfELNHNMCVYSTKKIVKLLQSNSSLNNPDKDGLDNSVDNSGLNGEiymkdnevinlnlyddlidsVKTGDRVTVVGil 372
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  240 ---------TYRCLPGKKGCYTSGTFRTVLIACNVKQMSKDI-----QPAFSADDIAKIKKFSktRSKDVFEQLARSLAP 305
Cdd:PTZ00111 373 kvtpirtstTRRTLKSLYTYFVNVIHVKVINSTNANQPEKGLkylgnENDFSDLQVYKILELS--RNPMIYRILLDSFAP 450
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  306 SIHGHDYVKKAILCLLLGGVERELENGSHI---------RGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGV 376
Cdd:PTZ00111 451 SIKARNNVKIGLLCQLFSGNKNSSDFNKSPdacykvdnfRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSV 530
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  377 GLTAAVT-TDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPV 455
Cdd:PTZ00111 531 GLTASIKfNESDNGRAMIQPGAVVLANGGVCCIDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPI 610
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  456 YGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRmhQYRAPGEQDGDAlplgssvdilatddpDFT 535
Cdd:PTZ00111 611 NSRYNKNKAVIENINISPSLFTRFDLIYLVLDHIDQDTDQLISLSIAK--DFLLPHMTGSGN---------------DED 673
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  536 QDDQQDTRIYEkhDSLLHgtKKKKEKMVSAAFMKKYIHVAKI-IKPTLTQESAAYIAEEYSRLRSQDSMSSDT------- 607
Cdd:PTZ00111 674 TYDRSNTMHVE--DESLR--SEKDYNKNDLDMLRMYIKFSKLhCFPKLSDEAKKVITREYVKMRQGNFQTSNLdelehaq 749
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33859484  608 -------------ARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLE 659
Cdd:PTZ00111 750 edddddlyyqssgTRMIYVSSRMISSIIRISVSLARMRLSTVVTPADALQAVQIVKSSTFQSLVD 814
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal domain of MCM proteins.
19-104 1.12e-14

MCM N-terminal domain; This family contains the N-terminal domain of MCM proteins.


Pssm-ID: 317013  Cd Length: 92  Bit Score: 72.28  E-value: 1.12e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    19 YLDFLD---DEEDQGIYQNKVRELISDNQYRLIVSVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQY 95
Cdd:pfam14551   1 FKDFLRefrEEDGEFKYRDQLREMAEREQRSLEVDLDDLREFDPELAEALLENPYEYLPLFEEALKEVVLELFPEYADEE 80
                          90
                  ....*....|..
gi 33859484    96 E---EFYIGLEG 104
Cdd:pfam14551  81 ElerEFQVRFYN 92
Cob-chelat-sub TIGR02442
cobaltochelatase subunit; Cobaltochelatase is responsible for the insertion of cobalt into the ...
387-761 3.07e-07

cobaltochelatase subunit; Cobaltochelatase is responsible for the insertion of cobalt into the corrin ring of coenzyme B12 during its biosynthesis. Two versions have been well described. CbiK/CbiX is a monomeric, anaerobic version which acts early in the biosynthesis (pfam06180). CobNST is a trimeric, ATP-dependent, aerobic version which acts late in the biosynthesis (TIGR02257/TIGR01650/TIGR01651). A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis.


Pssm-ID: 274135  Cd Length: 633  Bit Score: 53.92  E-value: 3.07e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   387 ETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPvygrydqyktpm 466
Cdd:TIGR02442 111 REGEKAFQPGLLAEAHRGILYIDEVNLLDDHLVDVLLDAAAMGVNRVEREGLSVSHPARFVLIGTMNP------------ 178
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   467 ENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLrmhqyrapgeqdgdalplgssvdilatddpdftqddqqdtrIYE 546
Cdd:TIGR02442 179 EEGDLRPQLLDRFGLCVDVAAPRDPEERVEIIRRRL-----------------------------------------AFD 217
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   547 KHDSLLHGTKKKKEKMVSAAfmkkyIHVAKIIKPT--LTQESAAYIAEEYSRlrsqdsMSSDTARTSPVTARTletlirl 624
Cdd:TIGR02442 218 ADPEAFAARWAAEQEELRNR-----IARARSLLPSvrISDSLIRFISELCIE------FGVDGHRADIVMARA------- 279
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   625 ATAHAKARMSKTVDLQDAEEAVELVQyayfkkvleKEKKRKKAsedesdledeEEKSQEDTEQKRKRRKTHAKDGESYDP 704
Cdd:TIGR02442 280 ARALAALDGRRRVTAEDVREAAELVL---------PHRRRRKP----------FEQPQGKDEKDLEEKPEEPGPDPEKPD 340
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 33859484   705 YDFSEAETQMPQVH-TPKTDDSQEktDDSQETQDSQkVELSEPRLKAFKAALLEVFQE 761
Cdd:TIGR02442 341 EGEDDAEQSGPRGHpTPGNDDEKE--PDPQEEADGQ-GSSTDPAGDIFRIRVLAPPQA 395
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
340-485 4.90e-04

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 40.98  E-value: 4.90e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 340 NILLIGDPSVAKSQLLRYVLCTAPRaipttgRGSSGVGLTAAVTT-------DQETGERRLEAGAMVLADRGVVCIDEFD 412
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFR------PGAPFLYLNASDLLeglvvaeLFGHFLVRLLFELAEKAKPGVLFIDEID 94
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 33859484 413 KMSDMDRTAIHEVMEQGRVTIAKagiharlNARCSVLAAANpvygrydqyktPMENIGLQDSLLSRFDLLFIM 485
Cdd:cd00009  95 SLSRGAQNALLRVLETLNDLRID-------RENVRVIGATN-----------RPLLGDLDRALYDRLDIRIVI 149
 
Name Accession Description Interval E-value
MCM smart00350
minichromosome maintenance proteins;
109-654 0e+00

minichromosome maintenance proteins;


Pssm-ID: 214631  Cd Length: 509  Bit Score: 728.67  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    109 KHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRS---VHYCPATKKTIERRYSDLTTLVAFPSSSVYPTkdeennPLE 185
Cdd:smart00350   1 KPSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRAsftCEKCGATLGPEIQSGRETEPTVCPPRECQSPT------PFS 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    186 TEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLP-GKKGCYTSGT--FRTVLIA 262
Cdd:smart00350  75 LNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVPyGFKLNTVKGLpvFATYIEA 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    263 CNVK----QMSKDIQP----AFSADDIAKIKKFSKtrSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSH 334
Cdd:smart00350 155 NHVRkldyKRSFEDSSfsvqSLSDEEEEEIRKLSK--DPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMK 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    335 IRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKM 414
Cdd:smart00350 233 IRGDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKM 312
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    415 SDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQD 494
Cdd:smart00350 313 DDSDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERD 392
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    495 REISDHVLRMHQYRAPGEQDGDalplgssvdilatddpdftqddqqdtriyekhdsllhgtkkkkEKMVSAAFMKKYIHV 574
Cdd:smart00350 393 RELAKHVVDLHRYSHPEEDEAF-------------------------------------------EPPLSQEKLRKYIAY 429
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    575 AK-IIKPTLTQESAAYIAEEYSRLRSQDSmSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAY 653
Cdd:smart00350 430 AReKIKPKLSEEAADKLVKAYVDLRKEDS-QTESRSSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRESI 508

                   .
gi 33859484    654 F 654
Cdd:smart00350 509 I 509
Mcm2 COG1241
DNA replicative helicase MCM subunit Mcm2, Cdc46/Mcm family [Replication, recombination and ...
17-662 0e+00

DNA replicative helicase MCM subunit Mcm2, Cdc46/Mcm family [Replication, recombination and repair];


Pssm-ID: 224162  Cd Length: 682  Bit Score: 581.23  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  17 RDYLDFLDDEEDQGIYQNKVrELISDNQYRLIVSVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYE 96
Cdd:COG1241   4 AELFRLRFKWEDILEYAENI-ILDKIINRSLEVDLSDLEEYDPELAGLLLENPEEIIPLFEKALDEIALLLFPEVDRSLK 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  97 EFYIGLEGSFgsKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLvafPSSSVYPT 176
Cdd:COG1241  83 KIHVRFKNLP--NRLSIRELRSEHIGKLVSVEGIVTRASEVRPRLKKAVFECPKCGREVEVEQSEFRVE---PPRECENC 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 177 KDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLPGKKGCY--TSG 254
Cdd:COG1241 158 GKFGKGPLKLVPRKSEFIDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDRVKITGVVRIVPSRSLSGrrKGP 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 255 TFRTVLIACNVKQMSKDIQPAFSADDIAKIKKFSKtrSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSH 334
Cdd:COG1241 238 VFEIYLEANSVEKLDKREEVEITEEDEEEIKELAK--RPDIYDILIKSIAPSIYGHEDVKKAILLQLFGGVKKNLPDGTR 315
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 335 IRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKM 414
Cdd:COG1241 316 IRGDIHILLVGDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGALVLADGGVCCIDEFDKM 395
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 415 SDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQD 494
Cdd:COG1241 396 NEEDRVAIHEAMEQQTISIAKAGITATLNARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLKDDPDEEKD 475
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 495 REISDHVLRMHQYRAPGEQDGDalplgSSVDILATDDPDftqddqqdtriyekhdsllhgtkkkkekmvsaaFMKKYIHV 574
Cdd:COG1241 476 EEIAEHILDKHRGEEPEETISL-----DGVDEVEERDFE---------------------------------LLRKYISY 517
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 575 AK-IIKPTLTQESAAYIAEEYSRLRsQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAY 653
Cdd:COG1241 518 ARkNVTPVLTEEAREELEDYYVEMR-KKSALVEEKRTIPITARQLESIIRLAEAHAKMRLSDVVEEEDVDEAIRLVDFSL 596

                ....*....
gi 33859484 654 FKKVLEKEK 662
Cdd:COG1241 597 KTVAVDPEK 605
MCM pfam00493
MCM2/3/5 family;
280-650 4.65e-159

MCM2/3/5 family;


Pssm-ID: 306894  Cd Length: 326  Bit Score: 469.70  E-value: 4.65e-159
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   280 DIAKIKKFSKtrSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSHIRGDINILLIGDPSVAKSQLLRYVL 359
Cdd:pfam00493   1 DEEEIKELAK--DPDIYEKLANSIAPSIYGHEDVKKAILLQLFGGVKKITPDGHRLRGDINVLLVGDPGTAKSQLLKYVE 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   360 CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIH 439
Cdd:pfam00493  79 KIAPRAVYTSGKGSSAAGLTAAVVRDPVTGEFVLEAGALVLADGGVCCIDEFDKMNESDRVALHEAMEQQTISIAKAGIV 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   440 ARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHQYRAPGEQDGDALP 519
Cdd:pfam00493 159 ATLNARCSVLAAANPIFGRYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEEKDERLAKHIVDLHRNSVEESIEGEMVE 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   520 LgssvdilatdDPDftqddqqdtriyekhdsllhgtkkkkekmvsaaFMKKYIHVAKIIKPTLTQESAAYIAEEYSRLRs 599
Cdd:pfam00493 239 I----------DPE---------------------------------LLRKYIAYARNIKPKLSDEAREKLVNYYVELR- 274
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 33859484   600 QDSMSSDtarTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQ 650
Cdd:pfam00493 275 KESQSTG---SIPITVRQLESLIRLSEAHAKLRLSEVVTEEDVEEAIRLIK 322
PTZ00111 PTZ00111
DNA replication licensing factor MCM4; Provisional
113-659 2.41e-78

DNA replication licensing factor MCM4; Provisional


Pssm-ID: 173403  Cd Length: 915  Bit Score: 273.79  E-value: 2.41e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  113 PRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVafpssSVYPTKDEENNPL-------- 184
Cdd:PTZ00111 218 VGNLEPSMADSLVQFSGTVVRQTWIVPEITMACFRCRGQKKIGLNDYQPCTCEH-----YEYVIQGEVNEPLlcnecnsk 292
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  185 ---ETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDK--------------------VKPGDRIQVVG-- 239
Cdd:PTZ00111 293 ytfELNHNMCVYSTKKIVKLLQSNSSLNNPDKDGLDNSVDNSGLNGEiymkdnevinlnlyddlidsVKTGDRVTVVGil 372
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  240 ---------TYRCLPGKKGCYTSGTFRTVLIACNVKQMSKDI-----QPAFSADDIAKIKKFSktRSKDVFEQLARSLAP 305
Cdd:PTZ00111 373 kvtpirtstTRRTLKSLYTYFVNVIHVKVINSTNANQPEKGLkylgnENDFSDLQVYKILELS--RNPMIYRILLDSFAP 450
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  306 SIHGHDYVKKAILCLLLGGVERELENGSHI---------RGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGV 376
Cdd:PTZ00111 451 SIKARNNVKIGLLCQLFSGNKNSSDFNKSPdacykvdnfRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSV 530
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  377 GLTAAVT-TDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPV 455
Cdd:PTZ00111 531 GLTASIKfNESDNGRAMIQPGAVVLANGGVCCIDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPI 610
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  456 YGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRmhQYRAPGEQDGDAlplgssvdilatddpDFT 535
Cdd:PTZ00111 611 NSRYNKNKAVIENINISPSLFTRFDLIYLVLDHIDQDTDQLISLSIAK--DFLLPHMTGSGN---------------DED 673
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484  536 QDDQQDTRIYEkhDSLLHgtKKKKEKMVSAAFMKKYIHVAKI-IKPTLTQESAAYIAEEYSRLRSQDSMSSDT------- 607
Cdd:PTZ00111 674 TYDRSNTMHVE--DESLR--SEKDYNKNDLDMLRMYIKFSKLhCFPKLSDEAKKVITREYVKMRQGNFQTSNLdelehaq 749
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33859484  608 -------------ARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLE 659
Cdd:PTZ00111 750 edddddlyyqssgTRMIYVSSRMISSIIRISVSLARMRLSTVVTPADALQAVQIVKSSTFQSLVD 814
MCM_OB pfam17207
MCM OB domain; This family contains an OB-fold found within MCM proteins. This domain contains ...
114-245 8.36e-37

MCM OB domain; This family contains an OB-fold found within MCM proteins. This domain contains an inserted zinc binding motif.


Pssm-ID: 319225  Cd Length: 127  Bit Score: 136.45  E-value: 8.36e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   114 RTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLttlvafPSSSVYPTKDEEN-NPLETEygLSV 192
Cdd:pfam17207   3 RDLRSEHIGKLVSVSGIVTRTSEVRPKLKKATFTCRKCGHTVQGEYTEG------PTKCPNPECGNKDpFVLVHE--KSK 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 33859484   193 YKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLP 245
Cdd:pfam17207  75 FVDFQKIKLQESPEEVPAGELPRSLDVILDDDLVDRVKPGDRVTVTGIYRVVP 127
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal domain of MCM proteins.
19-104 1.12e-14

MCM N-terminal domain; This family contains the N-terminal domain of MCM proteins.


Pssm-ID: 317013  Cd Length: 92  Bit Score: 72.28  E-value: 1.12e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484    19 YLDFLD---DEEDQGIYQNKVRELISDNQYRLIVSVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQY 95
Cdd:pfam14551   1 FKDFLRefrEEDGEFKYRDQLREMAEREQRSLEVDLDDLREFDPELAEALLENPYEYLPLFEEALKEVVLELFPEYADEE 80
                          90
                  ....*....|..
gi 33859484    96 E---EFYIGLEG 104
Cdd:pfam14551  81 ElerEFQVRFYN 92
MoxR COG0714
MoxR-like ATPase [General function prediction only];
297-499 2.67e-10

MoxR-like ATPase [General function prediction only];


Pssm-ID: 223786  Cd Length: 329  Bit Score: 62.45  E-value: 2.67e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 297 EQLARSLAPSIHGHDYVKKAIL-CLLLGGverelengshirgdiNILLIGDPSVAKSQL-----------LRYVLCTApr 364
Cdd:COG0714  16 GKIRSELEKVVVGDEEVIELALlALLAGG---------------HVLLEGPPGVGKTLLaralaralglpFVRIQCTP-- 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 365 aiptTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHaRLNA 444
Cdd:COG0714  79 ----DLLPSDLLGTYAYAALLLEPGEFRFVPGPLFAAVRVILLLDEINRAPPEVQNALLEALEERQVTVPGLTTI-RLPP 153
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 33859484 445 RCSVLAAANPVY--GRYDqyktpmenigLQDSLLSRFdLLFIMLDQMDPEQDREISD 499
Cdd:COG0714 154 PFIVIATQNPGEyeGTYP----------LPEALLDRF-LLRIYVDYPDSEEEERIIL 199
ChlI COG1239
Mg-chelatase subunit ChlI [Coenzyme transport and metabolism];
387-502 1.57e-07

Mg-chelatase subunit ChlI [Coenzyme transport and metabolism];


Pssm-ID: 224160  Cd Length: 423  Bit Score: 54.33  E-value: 1.57e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 387 ETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRydqyktpm 466
Cdd:COG1239 129 EEGPKAFQPGLLARANRGILYVDEVNLLDDHLVDALLDVAAEGVNDVEREGISIRHPARFLLIGTMNPEEGE-------- 200
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 33859484 467 enigLQDSLLSRFDLLfIMLDQ-MDPEQDREISDHVL 502
Cdd:COG1239 201 ----LRPQLLDRFGLE-VDTHYpLDLEERVEIIRRRL 232
Cob-chelat-sub TIGR02442
cobaltochelatase subunit; Cobaltochelatase is responsible for the insertion of cobalt into the ...
387-761 3.07e-07

cobaltochelatase subunit; Cobaltochelatase is responsible for the insertion of cobalt into the corrin ring of coenzyme B12 during its biosynthesis. Two versions have been well described. CbiK/CbiX is a monomeric, anaerobic version which acts early in the biosynthesis (pfam06180). CobNST is a trimeric, ATP-dependent, aerobic version which acts late in the biosynthesis (TIGR02257/TIGR01650/TIGR01651). A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis.


Pssm-ID: 274135  Cd Length: 633  Bit Score: 53.92  E-value: 3.07e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   387 ETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPvygrydqyktpm 466
Cdd:TIGR02442 111 REGEKAFQPGLLAEAHRGILYIDEVNLLDDHLVDVLLDAAAMGVNRVEREGLSVSHPARFVLIGTMNP------------ 178
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   467 ENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLrmhqyrapgeqdgdalplgssvdilatddpdftqddqqdtrIYE 546
Cdd:TIGR02442 179 EEGDLRPQLLDRFGLCVDVAAPRDPEERVEIIRRRL-----------------------------------------AFD 217
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   547 KHDSLLHGTKKKKEKMVSAAfmkkyIHVAKIIKPT--LTQESAAYIAEEYSRlrsqdsMSSDTARTSPVTARTletlirl 624
Cdd:TIGR02442 218 ADPEAFAARWAAEQEELRNR-----IARARSLLPSvrISDSLIRFISELCIE------FGVDGHRADIVMARA------- 279
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   625 ATAHAKARMSKTVDLQDAEEAVELVQyayfkkvleKEKKRKKAsedesdledeEEKSQEDTEQKRKRRKTHAKDGESYDP 704
Cdd:TIGR02442 280 ARALAALDGRRRVTAEDVREAAELVL---------PHRRRRKP----------FEQPQGKDEKDLEEKPEEPGPDPEKPD 340
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 33859484   705 YDFSEAETQMPQVH-TPKTDDSQEktDDSQETQDSQkVELSEPRLKAFKAALLEVFQE 761
Cdd:TIGR02442 341 EGEDDAEQSGPRGHpTPGNDDEKE--PDPQEEADGQ-GSSTDPAGDIFRIRVLAPPQA 395
AAA_5 pfam07728
AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not ...
340-479 6.23e-05

AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 311595  Cd Length: 135  Bit Score: 43.44  E-value: 6.23e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484   340 NILLIGDPSVAKSQLLRYV---LCTAPRAIpttgrgssgVGLTAAVTTDQETGERRLEAGAMVLADR---------GVVC 407
Cdd:pfam07728   1 GVLLVGPPGTGKTELAERLaaaLSNRPVFY---------VQLTRDTTEEDLFGRRNIDPGGASWVDGplvraaregEIAV 71
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33859484   408 IDEFDKMSDMDRTAIHEVMEQGRVTIAKAG--IHARLNARcSVLAAANPVYGRydqyktPMEnigLQDSLLSRF 479
Cdd:pfam07728  72 LDEINRANPDVLNSLLSLLDERRLLLPDGGelVKAAPDGF-RLIATMNPLDRG------LNE---LSPALRSRF 135
Mg_chelatase pfam01078
Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that ...
396-454 1.17e-04

Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that catalyzes the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.


Pssm-ID: 307292  Cd Length: 207  Bit Score: 44.06  E-value: 1.17e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 33859484   396 GAMVLADRGVVCIDEfdkMSDMDRTAI---HEVMEQGRVTIAKAGIHARLNARCSVLAAANP 454
Cdd:pfam01078 100 GEISLAHNGVLFLDE---LPEFKRRVLeslRQPLEDGEITISRARAKVTFPARFQLVAAMNP 158
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
340-485 4.90e-04

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 40.98  E-value: 4.90e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33859484 340 NILLIGDPSVAKSQLLRYVLCTAPRaipttgRGSSGVGLTAAVTT-------DQETGERRLEAGAMVLADRGVVCIDEFD 412
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFR------PGAPFLYLNASDLLeglvvaeLFGHFLVRLLFELAEKAKPGVLFIDEID 94
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 33859484 413 KMSDMDRTAIHEVMEQGRVTIAKagiharlNARCSVLAAANpvygrydqyktPMENIGLQDSLLSRFDLLFIM 485
Cdd:cd00009  95 SLSRGAQNALLRVLETLNDLRID-------RENVRVIGATN-----------RPLLGDLDRALYDRLDIRIVI 149
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH