NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|332865567|ref|XP_001144107|]
View 

PREDICTED: nuclear envelope pore membrane protein POM 121 isoform X2 [Pan troglodytes]

Protein Classification

POM121 and Atrophin-1 domain-containing protein (domain architecture ID 12172134)

protein containing domains POM121, Atrophin-1, and Nucleoporin_FG2

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
POM121 pfam15229
POM121 family;
307-541 6.45e-100

POM121 family;


:

Pssm-ID: 317613  Cd Length: 226  Bit Score: 319.31  E-value: 6.45e-100
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567   307 KEEKKRTVE-EEDQIFLDGQGNKRRCHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSF 385
Cdd:pfam15229    1 KESRKRTVKdEDDPSFTEGQDSKRRRPDSSGSAQSAFRPLVANGVPSSFVPKPGSLKRGLHSQSSEDSLNKRSRTSSMSS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567   386 LtgaytsgipsSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSCSQTPERPAKKIREEELcHHSSSSTPLAADKES 465
Cdd:pfam15229   81 C----------SKRNAITSSYSSTRGFPQLRKRSGPSSSPLSSPASSRSQTPERPAKKAREEEG-PQSSSSAPLKSDKES 149
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 332865567   466 QGEKAADTTPRKKQNS-NSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKAALQWFNQALE 541
Cdd:pfam15229  150 QGEKAADTPPGKKQNSwSSPPTPGSSRPRKRKIPLLPSRRGDPLTLPPPPQLGYRVTAEDLDLEKKAAIQWINKVLE 226
Nucleoporin_FG2 super family cl25599
Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of ...
1087-1203 2.48e-04

Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of chordate nucleoporins. The proteins carry many repeats of the FG sequence motif.


The actual alignment was detected with superfamily member pfam15967:

Pssm-ID: 330420  Cd Length: 593  Bit Score: 45.04  E-value: 2.48e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  1087 SPFTFGGSAAPAGS--GSFGINVATPGSSTTAGAFSFG-----AGQSGSTATSTPFAGGLGQNALGTTgQSTPFAFNvgs 1159
Cdd:pfam15967    1 SGFNFGSGGLGSTTtgGGFSFGAATSANATSTGGFSFGtllgaAAATPASTTTTTTSLGLGGGLFGQK-PAGGFSFN--- 76
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 332865567  1160 TPESkpvfgGTATPTFGLN--TPAPGVGTSGSSLSFGASSAPAQGF 1203
Cdd:pfam15967   77 TPAS-----GTAAPATGLTlgAPAATSAATGFSLAFNKPTASATPF 117
Atrophin-1 super family cl26464
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
568-752 3.03e-04

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 331285  Cd Length: 3151  Bit Score: 45.31  E-value: 3.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  568 AAATASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEALSPPKTPSllpplglsqsgppgplpsPSLDSKPL 647
Cdd:PHA03247 2673 AAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPA------------------AARQASPA 2734
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  648 TTLLGLIPAPSTVPATD-TKAPPTLQAETATKPlqAETATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSASPMF 726
Cdd:PHA03247 2735 LPAAPAPPAVPAGPATPgGPARPARPPTTAGPP--APAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVL 2812
                         170       180
                  ....*....|....*....|....*.
gi 332865567  727 KPIFTAPPKSEKEGLTPPGPSVTATA 752
Cdd:PHA03247 2813 APAAALPPAASPAGPLPPPTSAQPTA 2838
 
Name Accession Description Interval E-value
POM121 pfam15229
POM121 family;
307-541 6.45e-100

POM121 family;


Pssm-ID: 317613  Cd Length: 226  Bit Score: 319.31  E-value: 6.45e-100
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567   307 KEEKKRTVE-EEDQIFLDGQGNKRRCHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSF 385
Cdd:pfam15229    1 KESRKRTVKdEDDPSFTEGQDSKRRRPDSSGSAQSAFRPLVANGVPSSFVPKPGSLKRGLHSQSSEDSLNKRSRTSSMSS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567   386 LtgaytsgipsSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSCSQTPERPAKKIREEELcHHSSSSTPLAADKES 465
Cdd:pfam15229   81 C----------SKRNAITSSYSSTRGFPQLRKRSGPSSSPLSSPASSRSQTPERPAKKAREEEG-PQSSSSAPLKSDKES 149
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 332865567   466 QGEKAADTTPRKKQNS-NSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKAALQWFNQALE 541
Cdd:pfam15229  150 QGEKAADTPPGKKQNSwSSPPTPGSSRPRKRKIPLLPSRRGDPLTLPPPPQLGYRVTAEDLDLEKKAAIQWINKVLE 226
Nucleoporin_FG2 pfam15967
Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of ...
1087-1203 2.48e-04

Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of chordate nucleoporins. The proteins carry many repeats of the FG sequence motif.


Pssm-ID: 318232  Cd Length: 593  Bit Score: 45.04  E-value: 2.48e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  1087 SPFTFGGSAAPAGS--GSFGINVATPGSSTTAGAFSFG-----AGQSGSTATSTPFAGGLGQNALGTTgQSTPFAFNvgs 1159
Cdd:pfam15967    1 SGFNFGSGGLGSTTtgGGFSFGAATSANATSTGGFSFGtllgaAAATPASTTTTTTSLGLGGGLFGQK-PAGGFSFN--- 76
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 332865567  1160 TPESkpvfgGTATPTFGLN--TPAPGVGTSGSSLSFGASSAPAQGF 1203
Cdd:pfam15967   77 TPAS-----GTAAPATGLTlgAPAATSAATGFSLAFNKPTASATPF 117
PHA03247 PHA03247
large tegument protein UL36; Provisional
568-752 3.03e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 45.31  E-value: 3.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  568 AAATASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEALSPPKTPSllpplglsqsgppgplpsPSLDSKPL 647
Cdd:PHA03247 2673 AAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPA------------------AARQASPA 2734
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  648 TTLLGLIPAPSTVPATD-TKAPPTLQAETATKPlqAETATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSASPMF 726
Cdd:PHA03247 2735 LPAAPAPPAVPAGPATPgGPARPARPPTTAGPP--APAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVL 2812
                         170       180
                  ....*....|....*....|....*.
gi 332865567  727 KPIFTAPPKSEKEGLTPPGPSVTATA 752
Cdd:PHA03247 2813 APAAALPPAASPAGPLPPPTSAQPTA 2838
 
Name Accession Description Interval E-value
POM121 pfam15229
POM121 family;
307-541 6.45e-100

POM121 family;


Pssm-ID: 317613  Cd Length: 226  Bit Score: 319.31  E-value: 6.45e-100
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567   307 KEEKKRTVE-EEDQIFLDGQGNKRRCHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSF 385
Cdd:pfam15229    1 KESRKRTVKdEDDPSFTEGQDSKRRRPDSSGSAQSAFRPLVANGVPSSFVPKPGSLKRGLHSQSSEDSLNKRSRTSSMSS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567   386 LtgaytsgipsSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSCSQTPERPAKKIREEELcHHSSSSTPLAADKES 465
Cdd:pfam15229   81 C----------SKRNAITSSYSSTRGFPQLRKRSGPSSSPLSSPASSRSQTPERPAKKAREEEG-PQSSSSAPLKSDKES 149
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 332865567   466 QGEKAADTTPRKKQNS-NSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKAALQWFNQALE 541
Cdd:pfam15229  150 QGEKAADTPPGKKQNSwSSPPTPGSSRPRKRKIPLLPSRRGDPLTLPPPPQLGYRVTAEDLDLEKKAAIQWINKVLE 226
Nucleoporin_FG2 pfam15967
Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of ...
1087-1203 2.48e-04

Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of chordate nucleoporins. The proteins carry many repeats of the FG sequence motif.


Pssm-ID: 318232  Cd Length: 593  Bit Score: 45.04  E-value: 2.48e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  1087 SPFTFGGSAAPAGS--GSFGINVATPGSSTTAGAFSFG-----AGQSGSTATSTPFAGGLGQNALGTTgQSTPFAFNvgs 1159
Cdd:pfam15967    1 SGFNFGSGGLGSTTtgGGFSFGAATSANATSTGGFSFGtllgaAAATPASTTTTTTSLGLGGGLFGQK-PAGGFSFN--- 76
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 332865567  1160 TPESkpvfgGTATPTFGLN--TPAPGVGTSGSSLSFGASSAPAQGF 1203
Cdd:pfam15967   77 TPAS-----GTAAPATGLTlgAPAATSAATGFSLAFNKPTASATPF 117
PHA03247 PHA03247
large tegument protein UL36; Provisional
568-752 3.03e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 45.31  E-value: 3.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  568 AAATASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEALSPPKTPSllpplglsqsgppgplpsPSLDSKPL 647
Cdd:PHA03247 2673 AAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPA------------------AARQASPA 2734
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  648 TTLLGLIPAPSTVPATD-TKAPPTLQAETATKPlqAETATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSASPMF 726
Cdd:PHA03247 2735 LPAAPAPPAVPAGPATPgGPARPARPPTTAGPP--APAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVL 2812
                         170       180
                  ....*....|....*....|....*.
gi 332865567  727 KPIFTAPPKSEKEGLTPPGPSVTATA 752
Cdd:PHA03247 2813 APAAALPPAASPAGPLPPPTSAQPTA 2838
Nucleoporin_FG2 pfam15967
Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of ...
1037-1224 6.79e-04

Nucleoporin FG repeated region; Nucleoporin_FG2, or nucleoporin p58/p45, is a family of chordate nucleoporins. The proteins carry many repeats of the FG sequence motif.


Pssm-ID: 318232  Cd Length: 593  Bit Score: 43.50  E-value: 6.79e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  1037 AFGAPASSQPAFGGSTAVFPFGAATSSGFGATTQTASSGSSSSVFGSTTPSP-FTFGGSAAPAGSGSFGINVATPGSSTT 1115
Cdd:pfam15967   20 SFGAATSANATSTGGFSFGTLLGAAAATPASTTTTTTSLGLGGGLFGQKPAGgFSFNTPASGTAAPATGLTLGAPAATSA 99
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332865567  1116 AGAFSFGAGQSGSTAT--------STPFAGGL--GQNALGTTGQ---STPFAFNVGSTPESKP----------VFGGTAT 1172
Cdd:pfam15967  100 ATGFSLAFNKPTASATpfsltttsSSTAGAGLsfGSVLTSTAPQqpgATGFTLGLGGATTSTAastvlslgggLFSSTAA 179
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|..
gi 332865567  1173 PTFGLNTPAPGVGTSGSSLsFGASSAPAQGfvGVAPFGSAALSFSIGVGSKT 1224
Cdd:pfam15967  180 TGLGQTTLGAGGGLTLGSL-LATSTAPTAA--PAPSIGLGGVDFSTSSEKKS 228
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH