NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|332837235|ref|XP_508641|]
View 

PREDICTED: DNA polymerase delta subunit 3 isoform X1 [Pan troglodytes]

Protein Classification

CDC27 domain-containing protein (domain architecture ID 12100661)

CDC27 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CDC27 pfam09507
DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It ...
19-466 3.08e-123

DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterized by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif.


:

Pssm-ID: 312868  Cd Length: 427  Bit Score: 369.92  E-value: 3.08e-123
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235   19 KIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENsGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASI 98
Cdd:pfam09507   1 KIVTYRWLSRTLRVHVNQAKQMLYDFHESKRKKK-PAQLHATYLVSGRKAQNGHTCHKIVLVREDDLEEAKSEFETVVSV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235   99 HVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSSKKFEQshlhMSSETQANNELTTNGHG 178
Cdd:pfam09507  80 HIYSVQPAPLKDSNPLYDVDYDILKQNLKNCSRDSLIYGAQAGPIVNPNVKRRSGLVPP----PAPPASPPLETTAPGKT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  179 PPASKQVSQQPKGIMG-MFASKAAAKTQETNKETKTEAKEVTNASSAGN---KAPGKGNMMSNFFGKAAMNKLKVNLDSE 254
Cdd:pfam09507 156 PPVAKQSTKPPTGIMKsEFKAKSAAKSQDASKETTPEKAEKAPSVKAPSlkrSPSAKSNIMSAFFKAKPKNKKKKTLAKE 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  255 QAVKEEKIVEQPTVSVTEPKLATPaglKKSSKKAEPVKVLQkeKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSED 334
Cdd:pfam09507 236 QKVQEESAEQSGKEDVKLEDASAA---DEDEPEQLPTKSQQ--RRRQKRGESSDKEEPTRETRKERRERLKKMMEDDDDD 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  335 EVFSDSPgayeAESPSPLPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYVDGEGCIVTEKVYESESCTDSE 414
Cdd:pfam09507 311 DEMEDVP----ESPVATEEEETSPPPPLLKKEVEKEEVTESGDGRRRGRRRVMKKKTFKDEEGYMVTEKVYEWESFSEDE 386
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|...
gi 332837235  415 EELKMKTSSVHRPPAM-TVKKEPREerkgpkkgtaalGKANRQVSITGFFQRK 466
Cdd:pfam09507 387 DEPPVKKKPAVPKPAKpASAKKAKE------------PKAKGQGSIMSFFGKK 427
 
Name Accession Description Interval E-value
CDC27 pfam09507
DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It ...
19-466 3.08e-123

DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterized by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif.


Pssm-ID: 312868  Cd Length: 427  Bit Score: 369.92  E-value: 3.08e-123
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235   19 KIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENsGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASI 98
Cdd:pfam09507   1 KIVTYRWLSRTLRVHVNQAKQMLYDFHESKRKKK-PAQLHATYLVSGRKAQNGHTCHKIVLVREDDLEEAKSEFETVVSV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235   99 HVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSSKKFEQshlhMSSETQANNELTTNGHG 178
Cdd:pfam09507  80 HIYSVQPAPLKDSNPLYDVDYDILKQNLKNCSRDSLIYGAQAGPIVNPNVKRRSGLVPP----PAPPASPPLETTAPGKT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  179 PPASKQVSQQPKGIMG-MFASKAAAKTQETNKETKTEAKEVTNASSAGN---KAPGKGNMMSNFFGKAAMNKLKVNLDSE 254
Cdd:pfam09507 156 PPVAKQSTKPPTGIMKsEFKAKSAAKSQDASKETTPEKAEKAPSVKAPSlkrSPSAKSNIMSAFFKAKPKNKKKKTLAKE 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  255 QAVKEEKIVEQPTVSVTEPKLATPaglKKSSKKAEPVKVLQkeKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSED 334
Cdd:pfam09507 236 QKVQEESAEQSGKEDVKLEDASAA---DEDEPEQLPTKSQQ--RRRQKRGESSDKEEPTRETRKERRERLKKMMEDDDDD 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  335 EVFSDSPgayeAESPSPLPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYVDGEGCIVTEKVYESESCTDSE 414
Cdd:pfam09507 311 DEMEDVP----ESPVATEEEETSPPPPLLKKEVEKEEVTESGDGRRRGRRRVMKKKTFKDEEGYMVTEKVYEWESFSEDE 386
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|...
gi 332837235  415 EELKMKTSSVHRPPAM-TVKKEPREerkgpkkgtaalGKANRQVSITGFFQRK 466
Cdd:pfam09507 387 DEPPVKKKPAVPKPAKpASAKKAKE------------PKAKGQGSIMSFFGKK 427
PTZ00108 PTZ00108
DNA topoisomerase 2-like protein; Provisional
180-416 1.00e-04

DNA topoisomerase 2-like protein; Provisional


Pssm-ID: 240271  Cd Length: 1388  Bit Score: 44.65  E-value: 1.00e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  180 PASKQVSQQPKGIMGMFASKAAaKTQETNKETKTEAKEVTNASSAGNKAPGKGNMMSNF--FGKAAMNKLKVNLDSEQAV 257
Cdd:PTZ00108 1149 EKEIAKEQRLKSKTKGKASKLR-KPKLKKKEKKKKKSSADKSKKASVVGNSKRVDSDEKrkLDDKPDNKKSNSSGSDQED 1227
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  258 KEEKIVEQPTVSVTEPKL----ATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSE 333
Cdd:PTZ00108 1228 DEEQKTKPKKSSVKRLKSkknnSSKSSEDNDEFSSDDLSKEGKPKNAPKRVSAVQYSPPPPSKRPDGESNGGSKPSSPTK 1307
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  334 DEVFSDSPGaYEAESPSPLPPPSPPLEPVPKTEPEPPSVKSSSGENKRkRKRVLKSKTYVDGEGCIVTEKVYESESCTDS 413
Cdd:PTZ00108 1308 KKVKKRLEG-SLAALKKKKKSEKKTARKKKSKTRVKQASASQSSRLLR-RPRKKKSDSSSEDDDDSEVDDSEDEDDEDDE 1385

                  ...
gi 332837235  414 EEE 416
Cdd:PTZ00108 1386 DDD 1388
 
Name Accession Description Interval E-value
CDC27 pfam09507
DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It ...
19-466 3.08e-123

DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterized by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif.


Pssm-ID: 312868  Cd Length: 427  Bit Score: 369.92  E-value: 3.08e-123
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235   19 KIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENsGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASI 98
Cdd:pfam09507   1 KIVTYRWLSRTLRVHVNQAKQMLYDFHESKRKKK-PAQLHATYLVSGRKAQNGHTCHKIVLVREDDLEEAKSEFETVVSV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235   99 HVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSSKKFEQshlhMSSETQANNELTTNGHG 178
Cdd:pfam09507  80 HIYSVQPAPLKDSNPLYDVDYDILKQNLKNCSRDSLIYGAQAGPIVNPNVKRRSGLVPP----PAPPASPPLETTAPGKT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  179 PPASKQVSQQPKGIMG-MFASKAAAKTQETNKETKTEAKEVTNASSAGN---KAPGKGNMMSNFFGKAAMNKLKVNLDSE 254
Cdd:pfam09507 156 PPVAKQSTKPPTGIMKsEFKAKSAAKSQDASKETTPEKAEKAPSVKAPSlkrSPSAKSNIMSAFFKAKPKNKKKKTLAKE 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  255 QAVKEEKIVEQPTVSVTEPKLATPaglKKSSKKAEPVKVLQkeKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSED 334
Cdd:pfam09507 236 QKVQEESAEQSGKEDVKLEDASAA---DEDEPEQLPTKSQQ--RRRQKRGESSDKEEPTRETRKERRERLKKMMEDDDDD 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  335 EVFSDSPgayeAESPSPLPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYVDGEGCIVTEKVYESESCTDSE 414
Cdd:pfam09507 311 DEMEDVP----ESPVATEEEETSPPPPLLKKEVEKEEVTESGDGRRRGRRRVMKKKTFKDEEGYMVTEKVYEWESFSEDE 386
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|...
gi 332837235  415 EELKMKTSSVHRPPAM-TVKKEPREerkgpkkgtaalGKANRQVSITGFFQRK 466
Cdd:pfam09507 387 DEPPVKKKPAVPKPAKpASAKKAKE------------PKAKGQGSIMSFFGKK 427
PTZ00108 PTZ00108
DNA topoisomerase 2-like protein; Provisional
180-416 1.00e-04

DNA topoisomerase 2-like protein; Provisional


Pssm-ID: 240271  Cd Length: 1388  Bit Score: 44.65  E-value: 1.00e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  180 PASKQVSQQPKGIMGMFASKAAaKTQETNKETKTEAKEVTNASSAGNKAPGKGNMMSNF--FGKAAMNKLKVNLDSEQAV 257
Cdd:PTZ00108 1149 EKEIAKEQRLKSKTKGKASKLR-KPKLKKKEKKKKKSSADKSKKASVVGNSKRVDSDEKrkLDDKPDNKKSNSSGSDQED 1227
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  258 KEEKIVEQPTVSVTEPKL----ATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSE 333
Cdd:PTZ00108 1228 DEEQKTKPKKSSVKRLKSkknnSSKSSEDNDEFSSDDLSKEGKPKNAPKRVSAVQYSPPPPSKRPDGESNGGSKPSSPTK 1307
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332837235  334 DEVFSDSPGaYEAESPSPLPPPSPPLEPVPKTEPEPPSVKSSSGENKRkRKRVLKSKTYVDGEGCIVTEKVYESESCTDS 413
Cdd:PTZ00108 1308 KKVKKRLEG-SLAALKKKKKSEKKTARKKKSKTRVKQASASQSSRLLR-RPRKKKSDSSSEDDDDSEVDDSEDEDDEDDE 1385

                  ...
gi 332837235  414 EEE 416
Cdd:PTZ00108 1386 DDD 1388
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH