NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|33149327|ref|NP_444178|]
View 

vasopressin V1a receptor [Rattus norvegicus]

Protein Classification

7tmA_V1aR and DUF1856 domain-containing protein (domain architecture ID 11607497)

7tmA_V1aR and DUF1856 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_V1aR cd15385
vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G ...
52-365 0e+00

vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G protein-coupled receptors; V1a-type receptor is a G(q/11)-coupled receptor that mediates blood vessel constriction. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


:

Pssm-ID: 320507  Cd Length: 301  Bit Score: 549.81  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQ 131
Cdd:cd15385   1 KLEIAVLAVIFAVAVIGNSSVLLALYKTKKKASRMHLFIKHLSLADLVVAFFQVLPQLCWDITYRFYGPDFLCRIVKHLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 132 VFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEvnNGTKTQDCWATFIQ 211
Cdd:cd15385  81 VLGMFASTYMLVMMTADRYIAICHPLKTLQQPTKRSYLMIGSAWALSFILSTPQYFIFSLSEIE--NGSGVYDCWANFIV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDkgsgeavgpfhKGLLVTPCVSSVKSISRA 291
Cdd:cd15385 159 PWGIKAYITWITISIFVVPVIILLTCYGFICYNIWRNIKCKTRRGLSDNAL-----------KNILLAVCVSSVKTISRA 227
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd15385 228 KIRTVKMTFVIVLAYIVCWAPFFTIQMWSVWDQNFPWDESENTAVTITALLASLNSCCNPWIYMFFSGHLLQDF 301
DUF1856 pfam08983
Domain of unknown function (DUF1856); This domain has no known function. It is found in the ...
378-424 1.46e-21

Domain of unknown function (DUF1856); This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors.


:

Pssm-ID: 312513  Cd Length: 48  Bit Score: 88.34  E-value: 1.46e-21
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 33149327   378 KFAKDDSDSMSRRQTSYSN-NRSPTNSTGMWKDSPKSSKSIRFIPVST 424
Cdd:pfam08983   1 KLHKEDSDSSSRRQTLLTNtNRSPTNSTSLWKDSPKSSKSIKFIPVST 48
 
Name Accession Description Interval E-value
7tmA_V1aR cd15385
vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G ...
52-365 0e+00

vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G protein-coupled receptors; V1a-type receptor is a G(q/11)-coupled receptor that mediates blood vessel constriction. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320507  Cd Length: 301  Bit Score: 549.81  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQ 131
Cdd:cd15385   1 KLEIAVLAVIFAVAVIGNSSVLLALYKTKKKASRMHLFIKHLSLADLVVAFFQVLPQLCWDITYRFYGPDFLCRIVKHLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 132 VFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEvnNGTKTQDCWATFIQ 211
Cdd:cd15385  81 VLGMFASTYMLVMMTADRYIAICHPLKTLQQPTKRSYLMIGSAWALSFILSTPQYFIFSLSEIE--NGSGVYDCWANFIV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDkgsgeavgpfhKGLLVTPCVSSVKSISRA 291
Cdd:cd15385 159 PWGIKAYITWITISIFVVPVIILLTCYGFICYNIWRNIKCKTRRGLSDNAL-----------KNILLAVCVSSVKTISRA 227
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd15385 228 KIRTVKMTFVIVLAYIVCWAPFFTIQMWSVWDQNFPWDESENTAVTITALLASLNSCCNPWIYMFFSGHLLQDF 301
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
68-354 4.00e-45

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 159.40  E-value: 4.00e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327    68 GNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFqVLPQlcWDITYRFRG---PDWLCRVVKHLQVFAMFASAYMLVV 144
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLL-TLPF--WLVYALFGTwpfGSALCKLVTALDVVNGYASILLLTA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327   145 MTADRYIAVCHPLKTLQQPaRRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTktqDCWATFIQPWGTRAYVTWMTS 224
Cdd:pfam00001  78 ISIDRYLAIVHPLRYRRIM-RRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVT---SCLITFPESLWPVSYLLFSTV 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327   225 GVFVAPVVVLGTCYGFICYHIWRNIRGKTASsrhskgdkgsgeavgpfhkgllvtpcvssvksiSRAKIRTVKMTFVIVS 304
Cdd:pfam00001 154 VGFLLPLLVILVCYTRIIRTLRKQARSRRRS---------------------------------VRSERKALKTLLVVVV 200
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 33149327   305 AYILCWAPFFIVQMWSVWDENFIWTDS----ENPSITITALLASLNSCCNPWIY 354
Cdd:pfam00001 201 VFILCWLPYHILNLLDSLCDLLIIISCvvtpPRTLLQLTVWLAYSNSCLNPIIY 254
DUF1856 pfam08983
Domain of unknown function (DUF1856); This domain has no known function. It is found in the ...
378-424 1.46e-21

Domain of unknown function (DUF1856); This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors.


Pssm-ID: 312513  Cd Length: 48  Bit Score: 88.34  E-value: 1.46e-21
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 33149327   378 KFAKDDSDSMSRRQTSYSN-NRSPTNSTGMWKDSPKSSKSIRFIPVST 424
Cdd:pfam08983   1 KLHKEDSDSSSRRQTLLTNtNRSPTNSTSLWKDSPKSSKSIKFIPVST 48
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
55-358 1.53e-15

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 77.13  E-value: 1.53e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327   55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSrMHLFIRHLSLADLAvaFFQVLP-QLCWDITYRFRGPDWLCRVVKHLQVF 133
Cdd:PHA03087  44 IVVYSTIFFFGLVGNIIVIYVLTKTKIKTP-MDIYLLNLAVSDLL--FVMTLPfQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  134 AMFASAYMLVVMTADRYIAVCHPLKTLQ-QPARRSRLMIATSWVLSFILSTPQYFIFSVIE--------IEVNNGTKTQD 204
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKiNTVKYGYIVSLVIWIISIIETTPILFVYTTKKdhetliccMFYNNKTMNWK 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  205 CWATFIqpwgtrayvtwMTSGVFVAPVVVLGTCYgficYHIWRNIRGKTASSRhskgdkgsgeavgpfhkgllvtpcvss 284
Cdd:PHA03087 201 LFINFE-----------INIIGMLIPLTILLYCY----SKILITLKGINKSKK--------------------------- 238
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 33149327  285 vksisraKIRTVKMTFVIVSAYILCWAPF----FIVQMWSVWDENFIWTDSE-NPSITITALLASLNSCCNPWIYMFFS 358
Cdd:PHA03087 239 -------NKKAIKLVLIIVILFVIFWLPFnvsvFVYSLHILHFKSGCKAVKYiQYALHVTEIISLSHCCINPLIYAFVS 310
 
Name Accession Description Interval E-value
7tmA_V1aR cd15385
vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G ...
52-365 0e+00

vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G protein-coupled receptors; V1a-type receptor is a G(q/11)-coupled receptor that mediates blood vessel constriction. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320507  Cd Length: 301  Bit Score: 549.81  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQ 131
Cdd:cd15385   1 KLEIAVLAVIFAVAVIGNSSVLLALYKTKKKASRMHLFIKHLSLADLVVAFFQVLPQLCWDITYRFYGPDFLCRIVKHLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 132 VFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEvnNGTKTQDCWATFIQ 211
Cdd:cd15385  81 VLGMFASTYMLVMMTADRYIAICHPLKTLQQPTKRSYLMIGSAWALSFILSTPQYFIFSLSEIE--NGSGVYDCWANFIV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDkgsgeavgpfhKGLLVTPCVSSVKSISRA 291
Cdd:cd15385 159 PWGIKAYITWITISIFVVPVIILLTCYGFICYNIWRNIKCKTRRGLSDNAL-----------KNILLAVCVSSVKTISRA 227
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd15385 228 KIRTVKMTFVIVLAYIVCWAPFFTIQMWSVWDQNFPWDESENTAVTITALLASLNSCCNPWIYMFFSGHLLQDF 301
7tmA_V1bR cd15386
vasopressin receptor subtype 1B, member of the class A family of seven-transmembrane G ...
52-364 1.18e-155

vasopressin receptor subtype 1B, member of the class A family of seven-transmembrane G protein-coupled receptors; The V1b receptor is specifically expressed in corticotropes of the anterior pituitary and plays a critical role in regulating the activity of hypothalamic-pituitary-adrenal axis, a key part of the neuroendocrine system that controls reactions to stress, by maintaining adrenocorticotropic hormone (ACTH) and corticosterone levels. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320508  Cd Length: 302  Bit Score: 446.17  E-value: 1.18e-155
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQ 131
Cdd:cd15386   1 KVEIGVLAAILVVATAGNLAVLLAMYRMRRKMSRMHLFVLHLALTDLVVALFQVLPQLIWEITYRFQGPDLLCRAVKYLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 132 VFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVieIEVNNGTKTQDCWATFIQ 211
Cdd:cd15386  81 VLSMFASTYMLIMMTVDRYIAVCHPLRTLQQPSRQAYLMIGATWLLSCILSLPQVFIFSL--REVDQGSGVLDCWADFGF 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGdkGSGEAVGPFHkgllvtpcVSSVKSISRA 291
Cdd:cd15386 159 PWGAKAYITWTTLSIFVLPVAILIVCYSLICYEICKNLKGKTQTSRSEGG--GWRTQGMPSR--------VSSVRTISRA 228
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQD 364
Cdd:cd15386 229 KIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDENAPDEDSSDFAFTITMLLASLSSCCNPWIYMFFSGHLLQD 301
7tmA_Vasopressin_Oxytocin cd15196
vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G ...
52-365 5.01e-140

vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) and oxytocin are synthesized in the hypothalamus and are released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320324  Cd Length: 264  Bit Score: 405.08  E-value: 5.01e-140
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQ 131
Cdd:cd15196   1 KVEIAVLATILVLALFGNSCVLLVLYRRRRKLSRMHLFILHLSVADLLVALFNVLPQLIWDITYRFYGGDLLCRLVKYLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 132 VFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIevnnGTKTQDCWATFIQ 211
Cdd:cd15196  81 VVGMYASSYVLVATAIDRYIAICHPLSSHRWTSRRVHLMVAIAWVLSLLLSIPQLFIFSYQEV----GSGVYDCWATFEP 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWrnirgktassrhskgdkgsgeavgpfhkgllvtpcvssvksisRA 291
Cdd:cd15196 157 PWGLRAYITWFTVAVFVVPLIILAFCYGRICYVVW-------------------------------------------RA 193
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWtdsENPSITITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd15196 194 KIKTVKLTLVVVACYIVCWTPFFVVQMWAAWDPTAPI---EGPAFVIIMLLASLNSCTNPWIYLAFSGNLRRAL 264
7tmA_OT_R cd15387
oxytocin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
52-364 5.25e-127

oxytocin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Oxytocin is a peptide of nine amino acids synthesized in the hypothalamus and is released from the posterior pituitary gland. Oxytocin plays an important role in sexual reproduction of both sexes and is structurally very similar to vasopressin. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320509  Cd Length: 297  Bit Score: 373.00  E-value: 5.25e-127
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQ 131
Cdd:cd15387   1 KVEVTVLALILFLALTGNICVLLAIHTTRHKHSRMYFFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDFLCRLVKYLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 132 VFAMFASAYMLVVMTADRYIAVCHPLKTLQQpaRRSRLMIATSWVLSFILSTPQYFIFSVIEIevnnGTKTQDCWATFIQ 211
Cdd:cd15387  81 VVGMFASTYMLLLMSIDRCLAICQPLRSLHR--RSDRVYVLFSWLLSLVFSIPQVHIFSLREV----GNGVYDCWADFIQ 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDKGSGEAVgpfhkgllVTPCVSSVKSISRA 291
Cdd:cd15387 155 PWGPKAYITWITLSVYIIPVLILSVCYGLISFKIWQNVKLKTRRETKTPLSSAASGGA--------ALARVSSVKLISKA 226
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENfiwTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQD 364
Cdd:cd15387 227 KIRTVKMTFVIVLAYIVCWTPFFFVQMWSVWDPN---APKEASPFIIAMLLASLNSCCNPWIYMFFTGHLFHD 296
7tmA_Vasopressin-like cd14986
vasopressin receptors and its related G protein-coupled receptors, member of the class A ...
54-365 5.99e-122

vasopressin receptors and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this group form a subfamily within the class A G-protein coupled receptors (GPCRs), which includes the vasopressin and oxytocin receptors, the gonadotropin-releasing hormone receptors (GnRHRs), the neuropeptide S receptor (NPSR), and orphan GPR150. These receptors share significant sequence homology with each other, suggesting that they have a common evolutionary origin. Vasopressin, also known as arginine vasopressin or anti-diuretic hormone, is a neuropeptide synthesized in the hypothalamus. The actions of vasopressin are mediated by the interaction of this hormone with three tissue-specific subtypes: V1AR, V1BR, and V2R. Although vasopressin differs from oxytocin by only two amino acids, they have divergent physiological functions. Vasopressin is involved in regulating osmotic and cardiovascular homeostasis, whereas oxytocin plays an important role in the uterus during childbirth and in lactation. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR has also been associated with asthma and allergy. GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors.


Pssm-ID: 320117  Cd Length: 295  Bit Score: 360.15  E-value: 5.99e-122
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  54 EIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVF 133
Cdd:cd14986   3 RVAVLGVLFVFTLVGNGLVILVLRRKRKKRSRVNIFILNLAIADLVVAFFTVLTQIIWEATGEWVAGDVLCRIVKYLQVV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 134 AMFASAYMLVVMTADRYIAVCHPLKTLqQPARRSRLMIATSWVLSFILSTPQYFIFSviEIEVNNGTKtqDCWATFIQPW 213
Cdd:cd14986  83 GLFASTYILVSMSLDRYQAIVKPMSSL-KPRKRARLMIVVAWVLSFLFSIPQLVIFV--ERELGDGVH--QCWSSFYTPW 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 214 GTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDKGSGEAVGpfhkgllvtpcVSSVKSISRAKI 293
Cdd:cd14986 158 QRKVYITWLATYVFVIPLIILSYCYGRILRTIWIRSRQKTDRPIAPTAMSCRSVSCV-----------SSRVSLISRAKI 226
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 33149327 294 RTVKMTFVIVSAYILCWAPFFIVQMWSVWDEnfiWTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd14986 227 KTIKMTLVIILAFILCWTPYFIVQLLDVYAG---MQQLENDAYVVSETLASLNSALNPLIYGFFSSHLSFEH 295
7tmA_V2R cd15388
vasopressin receptor 2, member of the class A family of seven-transmembrane G protein-coupled ...
52-361 7.09e-120

vasopressin receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; The vasopressin type 2 receptor (V2R) is a G(s)-coupled receptor that controls balance of water and sodium ion by regulating their reabsorption in the renal collecting duct. Mutations of V2R is responsible for nephrogenic diabetes insipidus. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320510  Cd Length: 295  Bit Score: 354.85  E-value: 7.09e-120
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQ 131
Cdd:cd15388   1 QVEIAVLAIIFACALLSNSLVLLVLWRRRKQLARMHVFMLHLCIADLVVAFFQVLPQLVWDITDRFRGPDVLCRLVKYLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 132 VFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIevnnGTKTQDCWATFIQ 211
Cdd:cd15388  81 VVGMFASSYMIVAMTFDRHQAICRPMVTFQKGRARWNGPVCVAWAISLILSLPQVFIFSKVEV----APGVYECWACFIE 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTAssrhskgdkgsgEAVGPFHKGLLVTPCVSSVKSISRA 291
Cdd:cd15388 157 PWGLKAYVTWITLVVFVLPTLIITVCQVLIFKEIHINIYLKSQ------------IIVAVVKKKQLLSSRASSVAEVSKA 224
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIwtdSENPSITITALLASLNSCCNPWIYMFFSGHL 361
Cdd:cd15388 225 MIKTVKMTLVIVLVYVLCWAPFFLVQLWSVWDPKAP---TEGATFTILMLLASLNSCTNPWIYMAFSSSV 291
7tmA_NPSR cd15197
neuropeptide S receptor, member of the class A family of seven-transmembrane G protein-coupled ...
54-365 1.23e-72

neuropeptide S receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR is widely expressed in the brain, and its activation induces an elevation of intracellular calcium and cAMP concentrations, presumably by coupling to G(s) and G(q) proteins. Mutations in NPSR have been associated with an increased susceptibility to asthma. NPSR was originally identified as an orphan receptor GPR154 and is also known as G protein receptor for asthma susceptibility (GPRA) or vasopressin receptor-related receptor 1 (VRR1).


Pssm-ID: 320325  Cd Length: 294  Bit Score: 233.09  E-value: 1.23e-72
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  54 EIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVF 133
Cdd:cd15197   3 QLATLWVLFVFIVVGNSSVLFALWMRKAKKSRMNFFITQLAIADLCVGLINVLTDIIWRITVEWRAGDFACKVIRYLQVV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 134 AMFASAYMLVVMTADRYIAVCHPLKTLQQpARRSRLMIATSWVLSFILSTPQYFIFSviEIEVNNGtkTQDCWATFIQPW 213
Cdd:cd15197  83 VTYASTYVLVALSIDRYDAICHPMNFSQS-GRQARVLICVAWILSALFSIPMLIIFE--KTGLSNG--EVQCWILWPEPW 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 214 GTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDKGSGEAvgpfhkgllvtpcvSSVKSISRAKI 293
Cdd:cd15197 158 YWKVYMTIVAFLVFFIPATIISICYIIIVRTIWKKSKIQVTINKAGLHDGSSRRS--------------SSRGIIPRAKI 223
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 33149327 294 RTVKMTFVIVSAYILCWAPFFIVQMWSVWD------ENFIWTdsenpsiTITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd15197 224 KTIKMTFVIVTVFIICWSPYFVFDLLDVFGllprskTKIAAA-------TFIQSLAPLNSAINPLIYCLFSTHLCRPL 294
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
54-358 4.88e-59

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 196.73  E-value: 4.88e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  54 EIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVF 133
Cdd:cd00637   1 LAVLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLLVIPFSLVSLLLGGWWFGDALCKLLGFLQTV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 134 AMFASAYMLVVMTADRYIAVCHPLKTLQ-QPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEvnngtKTQDCWATFIQP 212
Cdd:cd00637  81 SLTASILTLTAISVDRYLAIVHPLRYRRrFTKRRAKLVIALIWLLSLLLALPPLLGWKVYEYG-----GYCCCCLCWPDL 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 213 WGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKgdkgsgeavgpfhkgllvtpcvssvKSISRAK 292
Cdd:cd00637 156 TLSKAYTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRKRISSSSNSSR-------------------------RRRRRRE 210
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 33149327 293 IRTVKMTFVIVSAYILCWAPFFIVQMWSVwdenFIWTDSENPSI--TITALLASLNSCCNPWIYMFFS 358
Cdd:cd00637 211 RKVTKMLLIVVVVFLLCWLPYFILFLLDV----FGPDPSPLPRIlyFLALLLAYLNSAINPIIYAFFN 274
7tmA_AKHR cd15382
adipokinetic hormone receptor, member of the class A family of seven-transmembrane G ...
55-358 3.76e-57

adipokinetic hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flight, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. AKH is structurally related to the mammalian gonadotropin-releasing hormone (GnRH) and they share a common ancestor. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320504  Cd Length: 298  Bit Score: 192.53  E-value: 3.76e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTP-RKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVF 133
Cdd:cd15382   4 IIVYSVLFLIAAVGNLTVLLILLRNRrRKRSRVNILLMHLAIADLLVTFIMMPLEIGWAATVAWLAGDFLCRLMLFFRAF 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 134 AMFASAYMLVVMTADRYIAVCHPLKTLQQPaRRSRLMIATSWVLSFILSTPQYFIFSVieievnngtKTQDCWATFIQ-- 211
Cdd:cd15382  84 GLYLSSFVLVCISLDRYFAILKPLRLSDAR-RRGRIMLAVAWVISFLCSIPQSFIFHV---------ESHPCVTWFSQcv 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGT-------RAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRnirgktaSSRHSKGDKGSGEAVGPFHKgllvtpcvSS 284
Cdd:cd15382 154 TFNFfpshdheLAYNIFNMITMYALPLIIIVFCYSLILCEISR-------KSKEKKEDVSEKSSSVRLRR--------SS 218
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 285 VKSISRAKIRTVKMTFVIVSAYILCWAPFFIVQMWSvwdenfiWTDSE-----NPSI-TITALLASLNSCCNPWIYMFFS 358
Cdd:cd15382 219 VGLLERARSRTLKMTIVIVLVFIICWTPYFIMSLWY-------WFDREsaskvDPRIqKGLFLFAVSNSCMNPIVYGYFS 291
7tmA_GnRHR-like cd15195
gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A ...
55-357 4.00e-54

gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Gonadotropin-releasing hormone (GnRH) and adipokinetic hormone (AKH) receptors share strong sequence homology to each other, suggesting that they have a common evolutionary origin. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flying, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320323  Cd Length: 293  Bit Score: 184.52  E-value: 4.00e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFA 134
Cdd:cd15195   4 VLVTWVLFVISAAGNLTVLIQLFRRRRAKSHIQILIMHLALADLMVTFFNMPMDAVWNYTVEWLAGDLMCRVMMFLKQFG 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 135 MFASAYMLVVMTADRYIAVCHPLKTLQQPaRRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKTQdC--WATFIQP 212
Cdd:cd15195  84 MYLSSFMLVVIALDRVFAILSPLSANQAR-KRVKIMLTVAWVLSALCSIPQSFIFSVLRKMPEQPGFHQ-CvdFGSAPTK 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 213 WGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDKGSGeavgpfhkgllvtpcvssvkSISRAK 292
Cdd:cd15195 162 KQERLYYFFTMILSFVIPLIITVTCYLLILFEISKMAKRARDTPISNRRRSRTN--------------------SLERAR 221
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33149327 293 IRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDsENPSITITALLASLNSCCNPWIYMFF 357
Cdd:cd15195 222 MRTLRMTALIVLTFIVCWGPYYVLGLWYWFDKESIKNL-PPALSHIMFLLGYLNPCLHPIIYGVF 285
7tmA_GnRHR_vertebrate cd15383
vertebrate gonadotropin-releasing hormone receptors, member of the class A family of ...
52-365 1.79e-53

vertebrate gonadotropin-releasing hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. GnRHR is expressed predominantly in the gonadotrope membrane of the anterior pituitary as well as found in nuemerous extrapituitary tissues including lymphocytes, breast, ovary, prostate, and cancer cell lines. There are at least two types of GnRH receptors, GnRHR1 and GnRHR2, which couple primarily to G proteins of the Gq/11 family. GnRHR is closely related to the adipokinetic hormone receptor (AKH), which binds to a lipid-mobilizing hormone that is involved in control of insect metabolism. They share a common ancestor and are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320505  Cd Length: 295  Bit Score: 182.95  E-value: 1.79e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  52 KLEIAVLAVIFVVAVLGNSSVLLALHRT-PRKTSRMHLFIRHLSLADLAVAFFqVLP-QLCWDITYRFRGPDWLCRVVKH 129
Cdd:cd15383   1 KVRVAVTFVLFVLSACSNLAVLWSATRNrRRKLSHVRILILHLAAADLLVTFV-VMPlDAAWNVTVQWYAGDLACRLLMF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 130 LQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQpARRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNnGTKTQdCwAT- 208
Cdd:cd15383  80 LKLFAMYSSAFVTVVISLDRHAAILNPLAIGSA-RRRNRIMLCAAWGLSALLALPQLFLFHTVTATPP-VNFTQ-C-ATh 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 209 --FIQPWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRniRGKTASSRHSKGdkgsgeavgpfhkgllvTPCVSSVK 286
Cdd:cd15383 156 gsFPAHWQETLYNMFTFFCLFLLPLLIMIFCYTRILLEISR--RMKEKKDSAKNE-----------------VALRSSSD 216
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 287 SISRAKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIwTDSENPSIT-ITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd15383 217 NIPKARMRTLKMTIVIVSSFIVCWTPYYLLGLWYWFSPEML-EQTVPESLShILFLFGLLNACLDPLIYGLFTISFRRGL 295
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
55-358 3.23e-52

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320095  Cd Length: 270  Bit Score: 178.75  E-value: 3.23e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFqVLPQLCWDITYRFRGP-DWLCRVVKHLQVF 133
Cdd:cd14964   2 FVLLLLIFLLGLLGNLLVLLVILRSRRLRTPTNLFLLNLALADLLFSLV-VVPFLLLGLLSGEWSFgFAGCKLVLFFFYL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 134 AMFASAYMLVVMTADRYIAVCHPLK-TLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIeieVNNGTKTQDCWATFIQP 212
Cdd:cd14964  81 FGFASIFLLTAMAIDRYLAICHPLKyTVLMTPRRARLLILGIWVLSLLLSLPPLLGWGTL---PFCGPNVPLLTLSCSDT 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 213 WGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDKgsgeavgpfhkgllvtpcvssvksisrak 292
Cdd:cd14964 158 AWNIAYTLGLLILGFLLPLLLILVSYARIVRALLRRKRITRSAISSARRER----------------------------- 208
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 33149327 293 iRTVKMTFVIVSAYILCWAPFFIVQMWSVWDEnfiWTDSENPSITITALLASLNSCCNPWIYMFFS 358
Cdd:cd14964 209 -KAFKTLLIVVLVFLLCWLPYHIVYLLPALLQ---LSNSLPLLLLLSVLLAVLNSCLNPLIYSLRN 270
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
55-358 4.93e-47

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124  Cd Length: 296  Bit Score: 165.85  E-value: 4.93e-47
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFA 134
Cdd:cd14993   4 IVLYVVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVADLLVSLFCMPLTLLENVYRPWVFGEVLCKAVPYLQGVS 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 135 MFASAYMLVVMTADRYIAVCHPLKTL-QQPARRSRLMIATSWVLSFILSTPQYFIFSV-IEIEVNNGTKTQD-CWATFIQ 211
Cdd:cd14993  84 VSASVLTLVAISIDRYLAICYPLKARrVSTKRRARIIIVAIWVIAIIIMLPLLVVYELeEIISSEPGTITIYiCTEDWPS 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSkgdkgsgeavgpfhkgllvtpcvSSVKSISRA 291
Cdd:cd14993 164 PELRKAYNVALFVVLYVLPLLIISVAYSLIGRRLWRRKPPGDRGSANS-----------------------TSSRRILRS 220
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSI--TITALLASLNSCCNPWIYMFFS 358
Cdd:cd14993 221 KKKVARMLIVVVVLFALSWLPYYVLSILLDFGPLSSEESDENFLLilPFAQLLGYSNSAINPIIYCFMS 289
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
68-354 4.00e-45

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 159.40  E-value: 4.00e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327    68 GNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFqVLPQlcWDITYRFRG---PDWLCRVVKHLQVFAMFASAYMLVV 144
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLL-TLPF--WLVYALFGTwpfGSALCKLVTALDVVNGYASILLLTA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327   145 MTADRYIAVCHPLKTLQQPaRRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTktqDCWATFIQPWGTRAYVTWMTS 224
Cdd:pfam00001  78 ISIDRYLAIVHPLRYRRIM-RRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVT---SCLITFPESLWPVSYLLFSTV 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327   225 GVFVAPVVVLGTCYGFICYHIWRNIRGKTASsrhskgdkgsgeavgpfhkgllvtpcvssvksiSRAKIRTVKMTFVIVS 304
Cdd:pfam00001 154 VGFLLPLLVILVCYTRIIRTLRKQARSRRRS---------------------------------VRSERKALKTLLVVVV 200
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 33149327   305 AYILCWAPFFIVQMWSVWDENFIWTDS----ENPSITITALLASLNSCCNPWIY 354
Cdd:pfam00001 201 VFILCWLPYHILNLLDSLCDLLIIISCvvtpPRTLLQLTVWLAYSNSCLNPIIY 254
7tmA_GnRHR_invertebrate cd15384
invertebrate gonadotropin-releasing hormone receptors, member of the class A family of ...
53-357 6.62e-45

invertebrate gonadotropin-releasing hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. GnRHR is expressed predominantly in the gonadotrope membrane of the anterior pituitary as well as found in nuemerous extrapituitary tissues including lymphocytes, breast, ovary, prostate, and cancer cell lines. There are at least two types of GnRH receptors, GnRHR1 and GnRHR2, which couple primarily to G proteins of the Gq/11 family. GnRHR is closely related to the adipokinetic hormone receptor (AKH), which binds to a lipid-mobilizing hormone that is involved in control of insect metabolism. They share a common ancestor and are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320506  Cd Length: 293  Bit Score: 159.91  E-value: 6.62e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  53 LEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQV 132
Cdd:cd15384   2 LKIVVLAVMFVISFIGNLLTIIQIYRLRRSRRTIYSLLLHLAIADLLVTFFCIPSEAIWAYTVAWLAGNTMCKLVKYLQV 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 133 FAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRlMIATSWVLSFILSTPQYFIFSViEIEVNNGTKTQdC--WATFI 210
Cdd:cd15384  82 FGLYLSTYITVLISLDRCVAILYPMKRNQAPERVRR-MVTVAWILSPIFSIPQAVIFHV-ERGPFVEDFHQ-CvtYGFYT 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 211 QPWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIwrnirgktasSRHSKGDKGSGEAVGPfhKGLLVTpcvssvKSISR 290
Cdd:cd15384 159 AEWQEQLYNMLSLVFMFPIPLVIMVTCYVLIFITL----------SKSSRDFQGLEIYTRN--RGPNRQ------RLFHK 220
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33149327 291 AKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFiwTDSENPSITITaLLASLNSCCNPWIYMFF 357
Cdd:cd15384 221 AKVKSLRMSAVIVTAFILCWTPYYVIMIWFLFFNPY--PLNDILFDVIF-FFGMSNSCVNPLIYGAF 284
7tmA_GPR150 cd15198
G protein-coupled receptor 150, member of the class A family of seven-transmembrane G ...
58-357 8.57e-42

G protein-coupled receptor 150, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors. Its endogenous ligand is not known. These receptors share a significant amino acid sequence similarity, suggesting that they have a common evolutionary origin.


Pssm-ID: 320326  Cd Length: 299  Bit Score: 151.88  E-value: 8.57e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  58 LAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWD-ITYRFRGPDWLCRVVKHLQVFAMF 136
Cdd:cd15198   7 LGVILVAGVAGNTTVLCWLCGGRRRKSRMNFLLLQLALADLLVIGGTALSQIIWElLGDRWMAGDVACRLLKLLQASARG 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 137 ASAYMLVVMTADRYIAVCHPLKtlqqPARRSRLMIATSWVLSFILSTPQYFIFSVIEIE--VNNGTKTQDCWATFI-QP- 212
Cdd:cd15198  87 ASANLVVLLALDRHQAIRAPLG----QPLRAWKLAALGWLLALLLALPQAYVFRVDFPDdpASAWPGHTLCRGIFApLPr 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 213 WGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRnirgktassrhsKGDKGSGEAVGPFHKGLLvtPCVSSVKS-ISRA 291
Cdd:cd15198 163 WHLQVYATYEAVVGFVAPVVILGVCYGRLLLKWWE------------RANQAPGAKKPWKKPSKS--HLRATAPSaLPRA 228
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENfiwtDSENPSI-TITALLASLNSCCNPWIYMFF 357
Cdd:cd15198 229 KVKTLKMTLVIALLFVGCSLPYFIAELAAAFGSG----DWEPEKVaAALGVMAVANSATNPFVFLFF 291
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
53-358 2.10e-34

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098  Cd Length: 259  Bit Score: 129.99  E-value: 2.10e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  53 LEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQV 132
Cdd:cd14967   1 LLAVFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVADLLVALLVMPFSAVYTLLGYWPFGPVLCRFWIALDV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 133 FAMFASAYMLVVMTADRYIAVCHPLKTLQQ-PARRSRLMIATSWVLSFILSTPQYFIFSVIEIEVnngtkTQDCWATFIQ 211
Cdd:cd14967  81 LCCTASILNLCAISLDRYLAITRPLRYRQLmTKKRALIMIAAVWVYSLLISLPPLVGWRDETQPS-----VVDCECEFTP 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PwgtRAYVTWMTSGVFVAPVVVLGTCYGFIcYHiwrnirgktassrhskgdkgsgeavgpfhkgllvtpcvssvksISRA 291
Cdd:cd14967 156 N---KIYVLVSSVISFFIPLLIMIVLYARI-FR-------------------------------------------VARR 188
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFiWTDSENpsITITALLASLNSCCNPWIYMFFS 358
Cdd:cd14967 189 ELKAAKTLAIIVGAFLLCWLPFFIIYLVSAFCPPD-CVPPIL--YAVFFWLGYLNSALNPIIYALFN 252
7tmA_FMRFamide_R-like cd14978
FMRFamide (Phe-Met-Arg-Phe) receptors and related proteins, member of the class A family of ...
57-358 2.36e-32

FMRFamide (Phe-Met-Arg-Phe) receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Drosophila melanogaster G-protein coupled FMRFamide (Phe-Met-Arg-Phe-NH2) receptor DrmFMRFa-R and related invertebrate receptors, as well as the vertebrate proteins GPR139 and GPR142. DrmFMRFa-R binds with high affinity to FMRFamide and intrinsic FMRFamide-related peptides. FMRFamide is a neuropeptide from the family of FMRFamide-related peptides (FaRPs), which all containing a C-terminal RFamide (Arg-Phe-NH2) motif and have diverse functions in the central and peripheral nervous systems. FMRFamide is an important neuropeptide in many types of invertebrates such as insects, nematodes, molluscs, and worms. In invertebrates, the FMRFamide-related peptides are involved in the regulation of heart rate, blood pressure, gut motility, feeding behavior, and reproduction. On the other hand, in vertebrates such as mice, they play a role in the modulation of morphine-induced antinociception. Orphan receptors GPR139 and GPR142 are very closely related G protein-coupled receptors, but they have different expression patterns in the brain and in other tissues. These receptors couple to inhibitory G proteins and activate phospholipase C. Studies suggested that dimer formation may be required for their proper function. GPR142 is predominantly expressed in pancreatic beta-cells and mediates enhancement of glucose-stimulated insulin secretion, whereas GPR139 is mostly expressed in the brain and is suggested to play a role in the control of locomotor activity. Tryptophan and phenylalanine have been identified as putative endogenous ligands of GPR139.


Pssm-ID: 320109  Cd Length: 299  Bit Score: 125.44  E-value: 2.36e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  57 VLAVIFVVAVLGNSSVLLALHRTPRKTSrMHLFIRHLSLADLAVAFFqVLPQLCWDITYRFRGPDW------LCRVVKHL 130
Cdd:cd14978   6 VLPVICIFGIIGNILNLVVLTRKSMRSS-INVYLAALAVSDILVLLS-ALPLFLLPYIRDYSSSFLsyfyayFLPYIYPL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 131 QVFAMFASAYMLVVMTADRYIAVCHPLKT-LQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKTQDCWAT- 208
Cdd:cd14978  84 ANTFQTASVWLTVALTVERYIAVCHPLKArTWCTPRRARRVILIIIIFSLLLNLPRFFEYEVVECENCNNNSYYYVIPTl 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 209 -FIQPWGTRAYVTWMTSGVFVA-PVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDKGSgeavgpfhkgllvtpcvssvk 286
Cdd:cd14978 164 lRQNETYLLKYYFWLYAIFVVLlPFILLLILNILLIRALRKSKKRRRLLRRRRRLLSRS--------------------- 222
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 33149327 287 siSRAKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFS 358
Cdd:cd14978 223 --QRRERRTTIMLIAVVIVFLICNLPAGILNILEAIFGESFLSPIYQLLGDISNLLVVLNSAVNFIIYCLFS 292
7tmA_PR4-like cd15392
neuropeptide Y receptor-like found in insect and related proteins, member of the class A ...
55-354 2.79e-32

neuropeptide Y receptor-like found in insect and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a novel G protein-coupled receptor (also known as PR4 receptor) from Drosophila melanogaster, which can be activated by the members of the neuropeptide Y (NPY) family, including NPY, peptide YY (PYY) and pancreatic polypeptide (PP), when expressed in Xenopus oocytes. These homologous peptides of 36-amino acids in length contain a hairpin-like structural motif, which referred to as the pancreatic polypeptide fold, and function as gastrointestinal hormones and neurotransmitters. The PR4 receptor also shares strong sequence homology to the mammalian tachykinin receptors (NK1R, NK2R, and NK3R), whose endogenous ligands are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB), respectively. The tachykinins function as excitatory transmitters on neurons and cells in the gastrointestinal tract.


Pssm-ID: 320514  Cd Length: 287  Bit Score: 124.78  E-value: 2.79e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVlPQLCWDITYRFRGP--DWLCRVVKHLQV 132
Cdd:cd15392   4 ILMYSTIFVLAVGGNGLVCYIVVSYPRMRTVTNYFIVNLALSDILMAVFCV-PFSFIALLILQYWPfgEFMCPVVNYLQA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 133 FAMFASAYMLVVMTADRYIAVCHPLKtLQQPARRSRLMIATSWVLSFILSTPQyFIFSVIEIEVNNGTKTQDCWATFIQP 212
Cdd:cd15392  83 VSVFVSAFTLVAISIDRYVAIMWPLR-PRMTKRQALLLIAVIWIFALATALPI-AITSRLFEDSNASCGQYICTESWPSD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 213 WGTRAYvTWMTSGV-FVAPVVVLGTCYGFICYHIWrnirgktassrhskGDKGSGEAVGpfhkgllvtpcvSSVKSISRA 291
Cdd:cd15392 161 TNRYIY-SLVLMILqYFVPLAVLVFTYTRIGIVVW--------------AKRTPGEAEN------------NRDQRMAES 213
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMwsVWDEN-FIWTDSENPSITITA-LLASLNSCCNPWIY 354
Cdd:cd15392 214 KRKLVKMMITVVAIFALCWLPLNILNL--VGDHDeSIYSWPYIPYLWLAAhWLAMSHCCYNPFIY 276
7tmA_CCK_R cd15206
cholecystokinin receptors, member of the class A family of seven-transmembrane G ...
53-356 1.57e-31

cholecystokinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320334  Cd Length: 269  Bit Score: 122.11  E-value: 1.57e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  53 LEIAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQV 132
Cdd:cd15206   2 LIIPLYSVIFLLAVVGNILVIVTLVQNKRMRTVTNVFLLNLAVSDLLLAVFCMPFTLVGQLLRNFIFGEVMCKLIPYFQA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 133 FAMFASAYMLVVMTADRYIAVCHPLKTLQ-QPARRSRLMIATSWVLSFILSTPqYFIFSviEIEVNNGTKTQDCWATFIQ 211
Cdd:cd15206  82 VSVSVSTFTLVAISLERYFAICHPLKSRVwQTLSHAYKVIAGIWLLSFLIMSP-ILVFS--NLIPMSRPGGHKCREVWPN 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWrnirgktassrhskgdkgsgeavgpfhkgllvtpcvssvksisRA 291
Cdd:cd15206 159 EIAEQAWYVFLDLMLLVIPGLVMSVAYGLISWTLL-------------------------------------------EA 195
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMF 356
Cdd:cd15206 196 KKRVIRMLFVIVVEFFICWTPLYVINTWKAFDPPSAARYVSSTTISLIQLLAYISSCVNPITYCF 260
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
55-357 7.71e-30

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331  Cd Length: 293  Bit Score: 117.71  E-value: 7.71e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFA 134
Cdd:cd15203   4 ILLYGLIIVLGVVGNLLVIYVVLRNKSMQTVTNIFILNLAVSDLLLCLVSLPFTLIYTLTKNWPFGSILCKLVPSLQGVS 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 135 MFASAYMLVVMTADRYIAVCHPLKTLQQPaRRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKtqdCWATFIQPWG 214
Cdd:cd15203  84 IFVSTLTLTAIAIDRYQLIVYPTRPRMSK-RHALLIIALIWILSLLLSLPLAIFQELSDVPIEILPY---CGYFCTESWP 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 215 TRAYVTWMTSGV----FVAPVVVLGTCYgficYHIWRNIRGKTASSRHSKGDKGSGEavgpfhkgllvtpcvssvKSISR 290
Cdd:cd15203 160 SSSSRLIYTISVlvlqFVIPLLIISFCY----FRISLKLRKRVKKKRGKRTLSSRRR------------------RSELR 217
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 33149327 291 AKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWtDSENPSI--TITALLASLNSCCNPWIYMFF 357
Cdd:cd15203 218 RKRRTNRLLIAMVVVFAVCWLPLNLFNLLRDFEPLPQI-DGRHFYLifLICHLIAMSSACVNPLLYGWL 285
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
55-360 1.07e-29

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132  Cd Length: 266  Bit Score: 116.99  E-value: 1.07e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFA 134
Cdd:cd15001   3 IIVYVITFVLGLIGNSLVIFVVARFRRMRSVTNVFLASLATADLLLLVFCVPLKTAEYFSPTWSLGAFLCKAVAYLQLLS 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 135 MFASAYMLVVMTADRYIAVCHPLKTL-QQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKTQDCWATFIQPW 213
Cdd:cd15001  83 FICSVLTLTAISIERYYVILHPMKAKsFCTIGRARKVALLIWILSAILASPVLFGQGLVRYESENGVTVYHCQKAWPSTL 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 214 GTRAYVTWMTSGVFVAPVVVLGTCYgficyhiwrnirgktassrhskgdkgsgeavgpfhkgllvtpcvssvksISRAKI 293
Cdd:cd15001 163 YSRLYVVYLAIVIFFIPLIVMTFAY-------------------------------------------------ARDTRK 193
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 33149327 294 RTVKMTFVIVSAYILCWAPFFIVQM-WSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH 360
Cdd:cd15001 194 QVIKMLISVVVLFAVCWGPLLIDNLlVSFDVISTLHTQALKYMRIAFHLLSYANSCINPIIYAFMSKN 261
7tmA_Opsins_type2_animals cd14969
type 2 opsins in animals, member of the class A family of seven-transmembrane G ...
56-358 1.15e-29

type 2 opsins in animals, member of the class A family of seven-transmembrane G protein-coupled receptors; This rhodopsin family represents the type 2 opsins found in vertebrates and invertebrates except sponge. Type 2 opsins primarily function as G protein coupled receptors and are responsible for vision as well as for circadian rhythm and pigment regulation. On the contrary, type 1 opsins such as bacteriorhodopsin and proteorhodopsin are found in both prokaryotic and eukaryotic microbes, functioning as light-gated ion channels, proton pumps, sensory receptors and in other unknown functions. Although these two opsin types share seven-transmembrane domain topology and a conserved lysine reside in the seventh helix, type 1 opsins do not activate G-proteins and are not evolutionarily related to type 2. Type 2 opsins can be classified into six distinct subfamilies including the vertebrate opsins/encephalopsins, the G(o) opsins, the G(s) opsins, the invertebrate G(q) opsins, the photoisomerases, and the neuropsins.


Pssm-ID: 320100  Cd Length: 284  Bit Score: 117.31  E-value: 1.15e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRvvkhLQVFAM 135
Cdd:cd14969   5 VYLSLIGVLGVVLNGLVILVFLKKKKLRTPLNLFLLNLALADLLMSVVGYPLSFYSNLSGRWSFGDPGCV----IYGFAV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 136 FASAYM----LVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEvnnGTKTqDC---WAT 208
Cdd:cd14969  81 TFLGLVsistLAALAFERYLVIVRPLKAFRLSKRRALILIAFIWLYGLFWALPPLFGWSSYVPE---GGGT-SCsvdWYS 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 209 fiQPWGTRAYVTWMTSGVFVAPVVVLGTCYgficYHIWRNIRGKTASSRHSKGDKGSgeavgpfhkgllvtpcvssvKSI 288
Cdd:cd14969 157 --KDPNSLSYIVSLFVFCFFLPLAIIIFCY----YKIYRTLRKMSKRAARRKNSAIT--------------------KRT 210
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 33149327 289 SRAKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENfiwtDSENP-SITITALLASLNSCCNPWIYMFFS 358
Cdd:cd14969 211 KKAEKKVAKMVLVMIVAFLIAWTPYAVVSLYVSFGGE----STIPPlLATIPALFAKSSTIYNPIIYVFMN 277
7tmA_UII-R cd14999
urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled ...
56-354 1.96e-29

urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The urotensin-II receptor (UII-R, also known as the hypocretin receptor) is a member of the class A rhodopsin-like G-protein coupled receptors, which binds the peptide hormone urotensin-II. Urotensin II (UII) is a vasoactive somatostatin-like or cortistatin-like peptide hormone. However, despite the apparent structural similarity to these peptide hormones, they are not homologous to UII. Urotensin II was first identified in fish spinal cord, but later found in humans and other mammals. In fish, UII is secreted at the back part of the spinal cord, in a neurosecretory centre called uroneurapophysa, and is involved in the regulation of the renal and cardiovascular systems. In mammals, urotensin II is the most potent mammalian vasoconstrictor identified to date and causes contraction of arterial blood vessels, including the thoracic aorta. The urotensin II receptor is a rhodopsin-like G-protein coupled receptor, which binds urotensin-II. The receptor was previously known as GPR14, or sensory epithelial neuropeptide-like receptor (SENR). The UII receptor is expressed in the CNS (cerebellum and spinal cord), skeletal muscle, pancreas, heart, endothelium and vascular smooth muscle. It is involved in the pathophysiological control of cardiovascular function and may also influence CNS and endocrine functions. Binding of urotensin II to the receptor leads to activation of phospholipase C, through coupling to G(q/11) family proteins. The resulting increase in intracellular calcium may cause the contraction of vascular smooth muscle.


Pssm-ID: 320130  Cd Length: 282  Bit Score: 116.39  E-value: 1.96e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAvaFFQVLPQlcwdITYRFRGPDWL-----CRVVKHL 130
Cdd:cd14999   4 TVLSLMCVVGVAGNVYTLVVMCLSMRPRASMYVYILNLALADLL--YLLTIPF----YVSTYFLKKWYfgdvgCRLLFSL 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 131 QVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEvNNGTKTQDCWATFI 210
Cdd:cd14999  78 DFLTMHASIFTLTVMSTERYLAVVKPLDTVKRSKSYRKLLAGVIWLLSLLLTLPMAIMIRLVTVE-DKSGGSKRICLPTW 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 211 QPWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKgdkgsgeavgpfhkgllvtpcvssvksisr 290
Cdd:cd14999 157 SEESYKVYLTLLFSTSIVIPGLVIGYLYIRLARKYWLSQAAASNSSRKRL------------------------------ 206
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33149327 291 AKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITI-TALLASLNSCCNPWIY 354
Cdd:cd14999 207 PKQKVLKMIFTIVLVFWACFLPFWIWQLLYLYSPSLSLSPRTTTYVNYlLTCLTYSNSCINPFLY 271
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
56-360 5.15e-29

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102  Cd Length: 281  Bit Score: 115.26  E-value: 5.15e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAM 135
Cdd:cd14971   5 LFFALIFLLGLVGNSLVILVVARNKPMRSTTNLFILNLAVADLTFLLFCVPFTATIYPLPGWVFGDFMCKFVHYFQQVSM 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 136 FASAYMLVVMTADRYIAVCHPLKTLQ-QPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKtqdCWATFIQPWG 214
Cdd:cd14971  85 HASIFTLVAMSLDRFLAVVYPLRSLHiRTPRNALAASGCIWVVSLAVAAPVLALHRLRNYTPGNRTV---CSEAWPSRAH 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 215 TRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHskgdkgsgeavgpfhkgllvtpcvssvksiSRAKIR 294
Cdd:cd14971 162 RRAFALCTFLFGYLLPLLLICVCYAAMLRHLWRVAVRPVLSEGS------------------------------RRAKRK 211
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 33149327 295 TVKMTFVIVSAYILCWAPFFIVQMWSVWDEnFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH 360
Cdd:cd14971 212 VTRLVLVVVVLFAACWGPIHAILLLVALGP-FPLTYATYALRIWAHCLAYSNSAVNPVLYAFLSEH 276
7tmA_TACR_family cd14992
tachykinin receptor and closely related proteins, member of the class A family of ...
56-358 7.29e-29

tachykinin receptor and closely related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family as well as closely related receptors. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320123  Cd Length: 291  Bit Score: 114.84  E-value: 7.29e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAM 135
Cdd:cd14992   5 VALVVIILVSVVGNFIVIAALARHKNLRGATNYFIASLAISDLLMALFCTPFNFTYVVSLSWEYGHFLCKIVNYLRTVSV 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 136 FASAYMLVVMTADRYIAVCHPLKT-LQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKTQDC--WATFIQP 212
Cdd:cd14992  85 YASSLTLTAIAFDRYFAIIHPLKPrHRQSYTTTVIIIITIWVVSLLLAIPQLYYATTEVLFSVKNQEKIFCcqIPPVDNK 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 213 WGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWrnirgktasSRHSKGDKGSGEavgpFHKGLlvtpcvssvksisRAK 292
Cdd:cd14992 165 TYEKVYFLLIFVVIFVLPLIVMTLAYARISRELW---------FRKVPGFSIKEV----ERKRL-------------KCK 218
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 33149327 293 IRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFS 358
Cdd:cd14992 219 RRVIKMLVCVVVLFVICWLPFHLFFLLRDFFPLIMKEKHTLQVYYFLHWIAMSNSMYNPIIYVTLN 284
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
56-358 8.78e-29

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101  Cd Length: 282  Bit Score: 114.70  E-value: 8.78e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADlaVAFFQVLPQLCWDI---TYRFrgPDWLCRVVKHLQV 132
Cdd:cd14970   5 AVYSVVCVVGLTGNSLVIYVILRYSKMKTVTNIYILNLAVAD--ELFLLGLPFLATSYllgYWPF--GEVMCKIVLSVDA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 133 FAMFASAYMLVVMTADRYIAVCHPLKTLQ--QPaRRSRLMIATSWVLSFILSTPqYFIFSVIeieVNNGTKTQDCWATFi 210
Cdd:cd14970  81 YNMFTSIFCLTVMSVDRYLAVVHPVKSLRfrTP-RKAKLVSLCVWALSLVLGLP-VIIFART---LQEEGGTISCNLQW- 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 211 qPWGTRAYVTWMTSGVFV----APVVVLGTCYGFICYHIwRNIRGKTASSRHSKGdkgsgeavgpfhkgllvtpcvssvk 286
Cdd:cd14970 155 -PDPPDYWGRVFTIYTFVlgfaVPLLVITVCYSLIIRRL-RSSRNLSTSGAREKR------------------------- 207
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 33149327 287 sisRAKIRTVKMTFVIVSAYILCWAPFFIVQMwsvwdenfIWTDSENPSITITALLASL-------NSCCNPWIYMFFS 358
Cdd:cd14970 208 ---RARRKVTRLVLVVVAVFVVCWLPFHVFQI--------VRLLIDPPETLTVVGVFLFcialsyaNSCLNPILYAFLD 275
7tmA_NPFFR cd15207
neuropeptide FF receptors, member of the class A family of seven-transmembrane G ...
55-358 3.23e-28

neuropeptide FF receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320335  Cd Length: 291  Bit Score: 113.10  E-value: 3.23e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFA 134
Cdd:cd15207   4 IVSYSLIFLLCVVGNVLVCLVVAKNPRMRTVTNYFILNLAVSDLLVGVFCMPFTLVDNILTGWPFGDVMCKLSPLVQGVS 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 135 MFASAYMLVVMTADRYIAVCHPlktlQQPA---RRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKTQDCWATFIQ 211
Cdd:cd15207  84 VAASVFTLVAIAVDRYRAVVHP----TEPKltnRQAFVIIVAIWVLALAIMIPQALVLEVKEYQFFRGQTVHICVEFWPS 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 212 PWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRnirgktaSSRHSKGDKGSGEAVGpfhkgllvtpcvssvksISRA 291
Cdd:cd15207 160 DEYRKAYTTSLFVLCYVAPLLIIAVLYVRIGYRLWF-------KPVPGGGSASREAQAA-----------------VSKK 215
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33149327 292 KIRTVKMTFVIVSAYILCWAPFFIVQMWSVWdENFiwtdSENPSITITA-------LLASLNSCCNPWIYMFFS 358
Cdd:cd15207 216 KVRVIKMLIVVVVLFALSWLPLHTVTMLDDF-GNL----SPNQREVLYVyiypiahWLAYFNSCVNPIVYGYFN 284
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
61-357 3.66e-28

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 320116  Cd Length: 284  Bit Score: 112.87  E-value: 3.66e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  61 IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAvaFFQVLPQLCWDITYRFRGP--DWLCRVVKHLQVFAMFAS 138
Cdd:cd14985  10 IFLVGLLGNLFVVWLFLLPRGPKRVADIFIANLAAADLV--FVLTLPLWATYTANQYDWPfgDFLCKVSSYAITVNMFAS 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 139 AYMLVVMTADRYIAVCHPLKT-LQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEvnNGTKTQDCWATFIQPWGTRA 217
Cdd:cd14985  88 VFLLTCMSVDRYLAIVHPVASrRLRRRRQARVTCALIWVVACLLSLPTFLLRSLQALP--DLNKTACIELYPHEAWHVGL 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 218 YVTWMTSGvFVAPVVVLGTCYgficYHIWRNIRGKTASSRHSKgdkgsgeavgpfhkgllvtpcvssvksisRAKIRTVK 297
Cdd:cd14985 166 SLVLNILG-FVLPLVIILTCY----CHIARTLRTHYERTGKGG-----------------------------RKRRKSLK 211
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33149327 298 MTFVIVSAYILCWAPF-------FIVQMWSVwdENFIWTDSENPSITITALLASLNSCCNPWIYMFF 357
Cdd:cd14985 212 IIFAVVVAFLVCWLPFhvfkfldFLAQLGAI--RPCFWEAFLDLGLPIATCLAFTNSCLNPFIYVFF 276
7tmA_leucokinin-like cd15393
leucokinin-like peptide receptor from tick and related proteins, member of the class A family ...
59-354 9.64e-28

leucokinin-like peptide receptor from tick and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a leucokinin-like peptide receptor from the Southern cattle tick, Boophilus microplus, a pest of cattle world-wide. Leucokinins are invertebrate neuropeptides that exhibit myotropic and diuretic activity. This receptor is the first neuropeptide receptor known from the Acari and the second known in the subfamily of leucokinin-like peptide G-protein-coupled receptors. The other known leucokinin-like peptide receptor is a lymnokinin receptor from the mollusc Lymnaeastagnalis.


Pssm-ID: 320515  Cd Length: 288  Bit Score: 111.73  E-value: 9.64e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  59 AVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFAS 138
Cdd:cd15393   8 GIISLVAVVGNFLVIWVVAKNRRMRTVTNIFIANLAVADIIIGLFSIPFQFQAALLQRWVLPRFMCPFCPFVQVLSVNVS 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 139 AYMLVVMTADRYIAVCHPLKTLQQPaRRSRLMIATSWVLSFILSTPQYFIFSVIE-IEVNNGTKTQDCWATFIQPWGTRA 217
Cdd:cd15393  88 VFTLTVIAVDRYRAVIHPLKARCSK-KSAKIIILIIWILALLVALPVALALRVEElTDKTNNGVKPFCLPVGPSDDWWKI 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 218 YVTWMTSGVFVAPVVVLGTCYGFICYHIWrnirgktassrhskGDKGSGEAVGpfhkgllvtpcvSSVKSISRAKIRTVK 297
Cdd:cd15393 167 YNLYLVCVQYFVPLVIICYAYTRIAVKIW--------------GTKAPGNAQD------------VRDDEILKNKKKVIK 220
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 33149327 298 MTFVIVSAYILCWAPFfivQMWSVWDE-----------NFIWTDSEnpsititaLLASLNSCCNPWIY 354
Cdd:cd15393 221 MLIIVVALFALCWLPL---QTYNLLNEikpeinkykyiNIIWFCSH--------WLAMSNSCYNPFIY 277
7tmA_OXR cd15208
orexin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
55-360 1.47e-27

orexin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Orexins (OXs, also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. Thus, activation of OX1R or OX2R will activate phospholipase activity and the phosphatidylinositol and calcium signaling pathways. Additionally, OX2R activation can also lead to inhibition of adenylate cyclase.


Pssm-ID: 320336  Cd Length: 303  Bit Score: 111.33  E-value: 1.47e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  55 IAVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFA 134
Cdd:cd15208   4 IALYILVFIVGLVGNVLVCFAVWRNHHMRTVTNYFIVNLSLADFLVIIICLPATLLVDVTETWFFGQVLCKIIPYLQTVS 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 135 MFASAYMLVVMTADRYIAVCHPLKtLQQPARRSRLMIATSWVLSFILSTPQYFI-----FSVIEIEVNNGTKTQDCWATF 209
Cdd:cd15208  84 VSVSVLTLSCIALDRWYAICHPLM-FKSTAKRARVSILIIWIVSLLIMIPQAIVmecsrVVPLANKTILLTVCDERWSDS 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 210 IQPwgtRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRHSKGDKGSGEAvgpfhkgllvtpcVSSVKSIS 289
Cdd:cd15208 163 IYQ---KVYHICFFLVTYLLPLCLMILAYFQIFRKLWCRQIPGTSSVVQRKWNKPRKSA-------------VAAEEKQL 226
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 33149327 290 RAKIRTVKMTFVIVSAYILCWAPFFIVQ-MWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH 360
Cdd:cd15208 227 RSRRKTAKMLIVVVIMFAICYLPVHLLNiLRYVFGLFTVDRETIYAWFLFSHWLVYANSAINPIIYNFMSGK 298
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
56-365 6.45e-27

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226  Cd Length: 282  Bit Score: 109.05  E-value: 6.45e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTP--RKTSRMHLFIRHLSLADLAVAFFQVLPQlcwDITYRFrgPDW-----LCRVVK 128
Cdd:cd15098   5 VVFGLIFCLGVLGNSLVITVLARVKpgKRRSTTNVFILNLSIADLFFLLFCVPFQ---ATIYSL--PEWvfgafMCKFVH 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 129 HLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLM-IATSWVLSFILSTPqyfiFSVIEIEVNNGTKTQD--C 205
Cdd:cd15098  80 YFFTVSMLVSIFTLVAMSVDRYIAVVHSRTSSSLRTRRNALLgVLVIWVLSLAMASP----VAVHQDLVHHWTASNQtfC 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 206 WATFIQPWGTRAYVTWMTSGVFVAPVVVLGTCYGFICYHIWRNIRGKTASSRhskgdkgsgeavgpfhkgllvtpcvssv 285
Cdd:cd15098 156 WENWPEKQQKPVYVVCTFVFGYLLPLLLITFCYAKVLNHLHKKLKNMSKKSE---------------------------- 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 286 ksisRAKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDeNFIWTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQDC 365
Cdd:cd15098 208 ----RSKKKTAQTVLVVVVVFGISWLPHHIIHLWVEFG-DFPLTQASFVLRITAHCLAYANSCVNPIIYAFLSENFRKAY 282
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
56-356 9.59e-27

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320113  Cd Length: 283  Bit Score: 108.51  E-value: 9.59e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFfqVLPQLcwdITYRFRGPDW-----LCRVVKHL 130
Cdd:cd14982   5 IVYSLIFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLFVL--TLPFR---IYYYLNGGWWpfgdfLCRLTGLL 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 131 QVFAMFASAYMLVVMTADRYIAVCHPLKTLQ-QPARRSRLMIATSWVLSFILSTPQYFIFSVIeIEVNNGTKTQDCWATF 209
Cdd:cd14982  80 FYINMYGSILFLTCISVDRYLAVVHPLKSRRlRRKRYAVGVCAGVWILVLAASVPLLLLRSTI-AKENNSTTCFEFLSEW 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 210 IQPWGTraYVTWMTSGVFVAPVVVLGTCYGFICyhiwRNIRGKTASSRHSKgdkgsgeavgpfhkgllvtpcvssvksis 289
Cdd:cd14982 159 LASAAP--LVLIALVVGFLIPLLIILVCYSLII----RALRRRSKQSQKSV----------------------------- 203
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 33149327 290 rAKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSIT-----ITALLASLNSCCNPWIYMF 356
Cdd:cd14982 204 -RKRKALRMILIVLAVFLVCFLPYHVTRILYLLVRLSVIADCSARNSLykayrITLCLASLNSCLDPLIYYF 274
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
56-358 1.87e-26

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224  Cd Length: 284  Bit Score: 107.77  E-value: 1.87e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327  56 AVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVlPQLCWD-ITYRFRGPDWLCRVVKHLQVFA 134
Cdd:cd15096   5 VIFGLIFIVGLIGNSLVILVVLSNQQMRSTTNILILNLAVADLLFVVFCV-PFTATDyVLPTWPFGDVWCKIVQYLVYVT 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 135 MFASAYMLVVMTADRYIAVCHPLKTLQ-QPARRSRLMIATSWVLSFILSTPQYFIFSVIEIeVNNGTKTQDCWATFIQPW 213
Cdd:cd15096  84 AYASVYTLVLMSLDRYLAVVHPITSMSiRTERNTLIAIVGIWIVILVANIPVLFLHGVVSY-GFSSEAYSYCTFLTEVGT 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33149327 214 GTRAY-VTWMTSGvFVA