NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|32475329|ref|NP_868323|]
View 

protein phosphatase 1 [Rhodopirellula baltica SH 1]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
10-262 1.25e-66

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


:

Pssm-ID: 223704  Cd Length: 262  Bit Score: 217.22  E-value: 1.25e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  10 KFAEQTHVGMRRANNQDSSAVLIAESAERLNqrghLFVVADGMGAHAAGELASQIASE----RISMHYYQSREEAPEHAI 85
Cdd:COG0631   9 KVAGLSDVGTVRKHNEDAFLIKPNENGNLLL----LFAVADGMGGHAAGEVASKLAVEalarLFDETNFNSLNESLEELL 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  86 SEAVHLANAAIYERGQSNPEFLNMGTTASSLVLVNGAAYVAHVGDSRVYRLRQGVLEQLTFDHSLVWEMQASGKVHSDSV 165
Cdd:COG0631  85 KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEA 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329 166 FSKSIpKNVITRSLGPSPEVLVDLEgPFDLEVGDRFMVCSDGLTGQIEDDELA-VLLDSLDVDKAARVMIDLANLRGGPD 244
Cdd:COG0631 165 RSHPR-RNALTRALGDFDLLEPDIT-ELELEPGDFLLLCSDGLWDVVSDDEIVdILKNSETPQEAADKLIELALEGGGPD 242
                       250
                ....*....|....*...
gi 32475329 245 NITLIVVEVDDEHLTQND 262
Cdd:COG0631 243 NITVVLVRLNGEGETSRD 260
 
Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
10-262 1.25e-66

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 217.22  E-value: 1.25e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  10 KFAEQTHVGMRRANNQDSSAVLIAESAERLNqrghLFVVADGMGAHAAGELASQIASE----RISMHYYQSREEAPEHAI 85
Cdd:COG0631   9 KVAGLSDVGTVRKHNEDAFLIKPNENGNLLL----LFAVADGMGGHAAGEVASKLAVEalarLFDETNFNSLNESLEELL 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  86 SEAVHLANAAIYERGQSNPEFLNMGTTASSLVLVNGAAYVAHVGDSRVYRLRQGVLEQLTFDHSLVWEMQASGKVHSDSV 165
Cdd:COG0631  85 KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEA 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329 166 FSKSIpKNVITRSLGPSPEVLVDLEgPFDLEVGDRFMVCSDGLTGQIEDDELA-VLLDSLDVDKAARVMIDLANLRGGPD 244
Cdd:COG0631 165 RSHPR-RNALTRALGDFDLLEPDIT-ELELEPGDFLLLCSDGLWDVVSDDEIVdILKNSETPQEAADKLIELALEGGGPD 242
                       250
                ....*....|....*...
gi 32475329 245 NITLIVVEVDDEHLTQND 262
Cdd:COG0631 243 NITVVLVRLNGEGETSRD 260
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
15-253 1.66e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 176.75  E-value: 1.66e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  15 THVGMRRANNQDSSAVLIaesaERLNQRGHLFVVADGMGAHAAGELASQIASERIS---MHYYQSREEAPEHAISEAVHL 91
Cdd:cd00143   6 SDKGGDRKTNEDAVVIKP----NLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLeelEETLTLSEEDIEEALRKAFLR 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  92 ANAAIYERGQSNPEFLNMGTTASSLVLVNGAAYVAHVGDSRVYRLRQGVLEQLTFDHSLVWE------MQASGKVHSDSV 165
Cdd:cd00143  82 ADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEeereriEKAGGRVSNGRV 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329 166 fsksIPKNVITRSLG---------PSPEVLVdlegpFDL-EVGDRFMVCSDGLTGQIEDDELAVLL----DSLDVDKAAR 231
Cdd:cd00143 162 ----PGVLAVTRALGdfdlkpgvsAEPDVTV-----VKLtEDDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQ 232
                       250       260
                ....*....|....*....|..
gi 32475329 232 VMIDLANLRGGPDNITLIVVEV 253
Cdd:cd00143 233 ELVDLALRRGSHDNITVVVVRL 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
20-251 1.14e-33

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 127.49  E-value: 1.14e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329     20 RRANNQDSSAVLIaesaeRLNQRGHLFVVADGMGAHAAGELASQIASERI--SMHYYQSREEAPEHAISEAVHLANAAIY 97
Cdd:smart00332  19 VRKPMEDAHVITP-----DLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILaeELIKEKDELEDVEEALRKAFLSTDEEIL 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329     98 ERGQSNpeflnMGTTASSLVLVNGAAYVAHVGDSRVYRLRQGVLEQLTFDHSL-----VWEMQASGKVHSDsvfSKSIPK 172
Cdd:smart00332  94 EELEAL-----SGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPsnedeRARIEAAGGFVIN---GRVNGV 165
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    173 NVITRSLG---------PSPEVLVDLEgpfdLEVGDRFMVCSDGLTGQIEDDE---LAVLLDSLDVDKAARVMIDLANLR 240
Cdd:smart00332 166 LALSRAIGdfflkpyvsAEPDVTVVEL----TEKDDFLILASDGLWDVLSNQEvvdIVRKHLSKDPKEAAKRLIDLALAR 241
                          250
                   ....*....|.
gi 32475329    241 GGPDNITLIVV 251
Cdd:smart00332 242 GSKDNITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
34-246 2.29e-11

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 278884  Cd Length: 253  Bit Score: 62.74  E-value: 2.29e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    34 ESAERLNQRGHLFVVADGMGAHAAGELAS----QIASERISmhYYQSreEAPEHAISEAvHLANAAiYERGQSNPEFLNM 109
Cdd:pfam00481  26 NSSGSGKDSRSFFAVFDGHGGSEAAKYCGkhlhTILALRRS--FLEG--EKLEDALRKS-FLEDTD-EVLRSAEKEDLDS 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   110 GTTASSLVLVNGAAYVAHVGDSRVYRLRQG-VLEQLTFDH--SLVWEM----QASGKVhsdSVFSKSIPKNVITRSLG-- 180
Cdd:pfam00481 100 GCTAVVALISGNKLYVANVGDSRAVLCRNGnAIKRLTKDHkpSDEDERrrirAAGGFV---SRNGRVNGVLAVSRAFGdf 176
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   181 ----------PSPEVLVdlegpFDLEVGDRFMV-CSDGLTGQIEDDEL-----AVLLDSLDVDKAARVMIDLANLRGGPD 244
Cdd:pfam00481 177 elkpgeqpvsAEPDITS-----VTITEDDEFLIlACDGLWDVLSDQEVvdlvrSELSDGGDPMEAAEELRDEAIAYGSED 251

                  ..
gi 32475329   245 NI 246
Cdd:pfam00481 252 NI 253
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
12-253 5.47e-36

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 139.81  E-value: 5.47e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   12 AEQTHVGMRRANNQD------SSAVLIAESAERLNQRGhLFVVADGMGAHAAGELASQIASERISmHYYQS--REEAPEH 83
Cdd:PRK14559 378 AGRTDVGRQRHHNEDyfgintRIQKLENPHGRIVQARG-LYILCDGMGGHAAGEVASALAVETLQ-QYFQQhwQDELPDE 455
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   84 A-ISEAVHLANAAIYERGQSNPEFLN--MGTTASSLVLVNGAAYVAHVGDSRVYRL-RQGVLEQLTFDHslvwemqasgk 159
Cdd:PRK14559 456 EtIREAIYLANEAIYDLNQQNARSGSgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDH----------- 524
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  160 vhsdSVFSKSIPKNV-------------ITRSLGP------SPEVlvdleGPFDLEVGDRFMVCSDGLTGQ--IE---DD 215
Cdd:PRK14559 525 ----EVGQREIQRGVepqiayarpdayqLTQALGPrdnsaiQPDI-----QFLEIEEDTLLLLCSDGLSDNdlLEthwQT 595
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 32475329  216 ELAVLLDS-LDVDKAARVMIDLANLRGGPDNITLIVVEV 253
Cdd:PRK14559 596 HLLPLLSSsANLDQGLNKLIDLANQYNGHDNITAILVRL 634
 
Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
10-262 1.25e-66

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 217.22  E-value: 1.25e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  10 KFAEQTHVGMRRANNQDSSAVLIAESAERLNqrghLFVVADGMGAHAAGELASQIASE----RISMHYYQSREEAPEHAI 85
Cdd:COG0631   9 KVAGLSDVGTVRKHNEDAFLIKPNENGNLLL----LFAVADGMGGHAAGEVASKLAVEalarLFDETNFNSLNESLEELL 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  86 SEAVHLANAAIYERGQSNPEFLNMGTTASSLVLVNGAAYVAHVGDSRVYRLRQGVLEQLTFDHSLVWEMQASGKVHSDSV 165
Cdd:COG0631  85 KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEA 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329 166 FSKSIpKNVITRSLGPSPEVLVDLEgPFDLEVGDRFMVCSDGLTGQIEDDELA-VLLDSLDVDKAARVMIDLANLRGGPD 244
Cdd:COG0631 165 RSHPR-RNALTRALGDFDLLEPDIT-ELELEPGDFLLLCSDGLWDVVSDDEIVdILKNSETPQEAADKLIELALEGGGPD 242
                       250
                ....*....|....*...
gi 32475329 245 NITLIVVEVDDEHLTQND 262
Cdd:COG0631 243 NITVVLVRLNGEGETSRD 260
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
15-253 1.66e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 176.75  E-value: 1.66e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  15 THVGMRRANNQDSSAVLIaesaERLNQRGHLFVVADGMGAHAAGELASQIASERIS---MHYYQSREEAPEHAISEAVHL 91
Cdd:cd00143   6 SDKGGDRKTNEDAVVIKP----NLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLeelEETLTLSEEDIEEALRKAFLR 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  92 ANAAIYERGQSNPEFLNMGTTASSLVLVNGAAYVAHVGDSRVYRLRQGVLEQLTFDHSLVWE------MQASGKVHSDSV 165
Cdd:cd00143  82 ADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEeereriEKAGGRVSNGRV 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329 166 fsksIPKNVITRSLG---------PSPEVLVdlegpFDL-EVGDRFMVCSDGLTGQIEDDELAVLL----DSLDVDKAAR 231
Cdd:cd00143 162 ----PGVLAVTRALGdfdlkpgvsAEPDVTV-----VKLtEDDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQ 232
                       250       260
                ....*....|....*....|..
gi 32475329 232 VMIDLANLRGGPDNITLIVVEV 253
Cdd:cd00143 233 ELVDLALRRGSHDNITVVVVRL 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
20-251 1.14e-33

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 127.49  E-value: 1.14e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329     20 RRANNQDSSAVLIaesaeRLNQRGHLFVVADGMGAHAAGELASQIASERI--SMHYYQSREEAPEHAISEAVHLANAAIY 97
Cdd:smart00332  19 VRKPMEDAHVITP-----DLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILaeELIKEKDELEDVEEALRKAFLSTDEEIL 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329     98 ERGQSNpeflnMGTTASSLVLVNGAAYVAHVGDSRVYRLRQGVLEQLTFDHSL-----VWEMQASGKVHSDsvfSKSIPK 172
Cdd:smart00332  94 EELEAL-----SGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPsnedeRARIEAAGGFVIN---GRVNGV 165
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    173 NVITRSLG---------PSPEVLVDLEgpfdLEVGDRFMVCSDGLTGQIEDDE---LAVLLDSLDVDKAARVMIDLANLR 240
Cdd:smart00332 166 LALSRAIGdfflkpyvsAEPDVTVVEL----TEKDDFLILASDGLWDVLSNQEvvdIVRKHLSKDPKEAAKRLIDLALAR 241
                          250
                   ....*....|.
gi 32475329    241 GGPDNITLIVV 251
Cdd:smart00332 242 GSKDNITVVVV 252
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
44-238 1.17e-16

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 77.77  E-value: 1.17e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329     44 HLFVVADGMGAHAAGELASQIASERIsmhyyqsREEAPE-HAISEAVHLANAAIYERGqsnpeFLNMGTTASSLVL--VN 120
Cdd:smart00331  31 LLIAIADVMGKGLAAALAMSMARSAL-------RTLLSEgISLSQILERLNRAIYENG-----EDGMFATLFLALYdfAG 98
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    121 GAAYVAHVGDSRVYRLRQGVLEQLTFDHSlvwemqasgkvhsdsvfsksipknviTRSLGPSPEVLVDLEGpFDLEVGDR 200
Cdd:smart00331  99 GTLSYANAGHSPPYLLRADGGLVEDLDDL--------------------------GAPLGLEPDVEVDVRE-LTLEPGDL 151
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|..
gi 32475329    201 FMVCSDGLTGQIEDDELAVLLDSL----DVDKAARVMIDLAN 238
Cdd:smart00331 152 LLLYTDGLTEARNPERLEELLEELlgspPAEIAQRILEELLE 193
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
34-246 2.29e-11

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 278884  Cd Length: 253  Bit Score: 62.74  E-value: 2.29e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    34 ESAERLNQRGHLFVVADGMGAHAAGELAS----QIASERISmhYYQSreEAPEHAISEAvHLANAAiYERGQSNPEFLNM 109
Cdd:pfam00481  26 NSSGSGKDSRSFFAVFDGHGGSEAAKYCGkhlhTILALRRS--FLEG--EKLEDALRKS-FLEDTD-EVLRSAEKEDLDS 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   110 GTTASSLVLVNGAAYVAHVGDSRVYRLRQG-VLEQLTFDH--SLVWEM----QASGKVhsdSVFSKSIPKNVITRSLG-- 180
Cdd:pfam00481 100 GCTAVVALISGNKLYVANVGDSRAVLCRNGnAIKRLTKDHkpSDEDERrrirAAGGFV---SRNGRVNGVLAVSRAFGdf 176
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   181 ----------PSPEVLVdlegpFDLEVGDRFMV-CSDGLTGQIEDDEL-----AVLLDSLDVDKAARVMIDLANLRGGPD 244
Cdd:pfam00481 177 elkpgeqpvsAEPDITS-----VTITEDDEFLIlACDGLWDVLSDQEVvdlvrSELSDGGDPMEAAEELRDEAIAYGSED 251

                  ..
gi 32475329   245 NI 246
Cdd:pfam00481 252 NI 253
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
20-236 4.95e-07

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 290397  Cd Length: 209  Bit Score: 49.23  E-value: 4.95e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    20 RRANNQDSSAVLIAESAErlnqrghLFVVADGMGAHAAGELASQIASERI--SMHYYQSREEAP-EHAISEAVHLANAAI 96
Cdd:pfam13672   8 RGLPCQDAFAVWVLSGGS-------LIAVADGAGSAKLSDVGARIAVEAAveALADLLESEEEEiEALLRAILNDWLALV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    97 YERGQSNP-EFLNMGTTASSLVLVNGAAYVAHVGDSR-VYRLRQGVLEQLTFDHSLVWEMQasgkvhsdsvfsksipknv 174
Cdd:pfam13672  81 KEEAEARGlEPRDYATTLLAAVVTPGGIVFFQIGDGAiVVRDRDGEVQVLSQPDSGEYANE------------------- 141
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 32475329   175 iTRSLgPSPEVLVDLE-GPFDLEVGDRFMVCSDGLTGQIEDDE-----LAVLLDSLDVDKAARVMIDL 236
Cdd:pfam13672 142 -TTFL-TSEDALDELRiRRLPLEPGDALALMTDGLANSLVDEEpfvpfFAPLFRTLEKEGAAEQLVDF 207
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
45-253 3.59e-04

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 40.31  E-value: 3.59e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329    45 LFVVADGMGaH--AAGELASQIaseRISMHYYQSREEAPehaiSEAVHLANAAIYERGQSNpeflnMGTTASSLVL--VN 120
Cdd:pfam07228   5 ALVIGDVMG-HglPAALLMGML---RTALRALAAEGLDP----AEVLKRLNRLLQRNLEED-----MFATAVLAVYdpET 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   121 GAAYVAHVGDSRVYRLR--QGVLEQLTfdhslvwemqasgkvhsdsvfSKSIPknvitrsLGPSPEVLVDlEGPFDLEVG 198
Cdd:pfam07228  72 GTLEYANAGHPPPLLLRpdGGVVELLE---------------------STGLP-------LGILPDADYE-VVELELEPG 122
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 32475329   199 DRFMVCSDGLT-------GQIEDDELAVLLDS---LDVDKAARVMIDLANLRGGP---DNITLIVVEV 253
Cdd:pfam07228 123 DTLLLYTDGLTeardpdgELFGLERLLALLAErhgLPPEELLDALLEALLRLGGGeleDDITLLVLRV 190
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
12-253 5.47e-36

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 139.81  E-value: 5.47e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   12 AEQTHVGMRRANNQD------SSAVLIAESAERLNQRGhLFVVADGMGAHAAGELASQIASERISmHYYQS--REEAPEH 83
Cdd:PRK14559 378 AGRTDVGRQRHHNEDyfgintRIQKLENPHGRIVQARG-LYILCDGMGGHAAGEVASALAVETLQ-QYFQQhwQDELPDE 455
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329   84 A-ISEAVHLANAAIYERGQSNPEFLN--MGTTASSLVLVNGAAYVAHVGDSRVYRL-RQGVLEQLTFDHslvwemqasgk 159
Cdd:PRK14559 456 EtIREAIYLANEAIYDLNQQNARSGSgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDH----------- 524
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32475329  160 vhsdSVFSKSIPKNV-------------ITRSLGP------SPEVlvdleGPFDLEVGDRFMVCSDGLTGQ--IE---DD 215
Cdd:PRK14559 525 ----EVGQREIQRGVepqiayarpdayqLTQALGPrdnsaiQPDI-----QFLEIEEDTLLLLCSDGLSDNdlLEthwQT 595
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 32475329  216 ELAVLLDS-LDVDKAARVMIDLANLRGGPDNITLIVVEV 253
Cdd:PRK14559 596 HLLPLLSSsANLDQGLNKLIDLANQYNGHDNITAILVRL 634
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH