NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|320542214|ref|NP_001188644|]
View 

paralytic, isoform AW [Drosophila melanogaster]

Protein Classification

Ion_trans and Na_channel_gate domain-containing protein (domain architecture ID 11998267)

protein containing domains Na_trans_cytopl, Na_trans_assoc, Ion_trans, and Na_channel_gate

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1231-1502 2.07e-64

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 222.53  E-value: 2.07e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1231 NKYFETAVITMILMSSLALALEDVHLPQRPiLQDILYYMDRIFTVIFFLEMLIKWLALGFKV-YFTNAWCWLDFVIVMVS 1309
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEP-LTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1310 LINFVASLVGAGGIqaFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFK 1389
Cdd:pfam00520   80 LISLVLSSVGSLSG--LRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1390 CEDMNgtklsheiipnrnacesenytwvNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREvdkqpiretNIYMYL 1469
Cdd:pfam00520  158 WENPD-----------------------NGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFWAYI 205
                          250       260       270
                   ....*....|....*....|....*....|...
gi 320542214  1470 YFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAG 1502
Cdd:pfam00520  206 YFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1552-1802 9.85e-54

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 191.71  E-value: 9.85e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1552 FDIIIMLFIGLNMFTMTLDRYDASD-TYNAVLDYLNAIFVVIFSSECLLKIFA--LRYHYFIEPWNLFDVVVVILSILGL 1628
Cdd:pfam00520    4 FELFILLLILLNTIFLALETYFQPEePLTTVLEILDYVFTGIFTLEMLLKIIAagFKKRYFRSPWNILDFVVVLPSLISL 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1629 VLSDIiekyfVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV--KE 1706
Cdd:pfam00520   84 VLSSV-----GSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKlkTW 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1707 KSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEacdppdndkgypgncgSATVGITFLLSYLVISFLIVINMY 1786
Cdd:pfam00520  159 ENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK----------------GEFWAYIYFVSFIILGGFLLLNLF 222
                          250
                   ....*....|....*.
gi 320542214  1787 IAVILENYSQATEDVQ 1802
Cdd:pfam00520  223 IAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
761-972 1.42e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 170.91  E-value: 1.42e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   761 DPFVELFITLCIVVNTMFMAMDHHDMNKE-MERVLKSGNYFFTATFAIEATMKLMAMSPKY-YFQEGWNIFDFIIVAL-- 836
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPsl 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   837 -SLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKd 915
Cdd:pfam00520   81 iSLVLSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE- 159
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 320542214   916 rfpDGDLPRWNFTDFMHSFMIVFRVLCGE-WIESMWDCM-YVGDVSCIPFFLATVVIGN 972
Cdd:pfam00520  160 ---NPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIdGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
141-425 1.65e-45

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 167.83  E-value: 1.65e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   141 HPLFSLFIITTILVNCILMIM--------PTTPTVESTEVIFTGIYTFESAVKVMARGFIlcpFTYLRDAWNWLDFVVIA 212
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALetyfqpeePLTTVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   213 LAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLtq 288
Cdd:pfam00520   78 PSLISLVLSsvgsLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   289 kcikkfpldGSWGnltdenwdyhnrnssnwysedegisfplcgnisgagqcdddyvclqgfgpNPNYGYTSFDSFGWAFL 368
Cdd:pfam00520  156 ---------KTWE--------------------------------------------------NPDNGRTNFDNFPNAFL 176
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 320542214   369 SAFRLMTQDFWEDLYQLVLRAAGP-WHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 425
Cdd:pfam00520  177 WLFQTMTTEGWGDIMYDTIDGKGEfWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELT 234
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1492-1544 1.08e-27

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 110.35  E-value: 1.08e-27
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 320542214 1492 DNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVF 1544
Cdd:cd13433     1 DNFNQLKKKYGGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
998-1227 6.58e-27

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


:

Pssm-ID: 310839  Cd Length: 195  Bit Score: 112.42  E-value: 6.58e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   998 DNDTNKIAEAFNRIGRFKSWVKRNIAD-CFKLIR----------------NKLTNQISDQPsgkGVCRCISAEHGDNELE 1060
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRNLRDfCHRPCLrppppvkkplsslkaaRSKENHIANHT---ATGPEAPRELEDDHLD 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1061 LGHDeiladglikkgikeqTQLEVA--IGDGMeftihgdmknnkpkkSKyLNNATDDDTASINSYgshknrpfkDESHKG 1138
Cdd:pfam06512   78 FITN---------------PNLTVSvpIAEGE---------------SD-LENEEDDDEDSQSSD---------EEKSKQ 117
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1139 SAETMEGEEKRDASKEDLGLDEELdeegeceegPLDGDIIIHAHDEDILDeyPADCCPDSYYKKFPILAGDDDSPFWQGW 1218
Cdd:pfam06512  118 SQEQLQEELDDSSSSEGSTVDLQD---------PEEELEKIPEEAEELEE--PEDCFTEGCVRRFPCCAVDITKGPWKIW 186

                   ....*....
gi 320542214  1219 GNLRLKTFQ 1227
Cdd:pfam06512  187 WNLRKTCYR 195
Na_trans_cytopl super family cl13384
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
504-627 2.08e-20

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


The actual alignment was detected with superfamily member pfam11933:

Pssm-ID: 314757  Cd Length: 164  Bit Score: 92.49  E-value: 2.08e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   504 NKEKMSIRSVEVESESY-------TIRNGRGRFGIPGSDRKPLVLSTYQ----------------------------DAQ 548
Cdd:pfam11933    1 RKKKKSEGEEKGDDEKFpksesddSIRRKGFRFSVDRLAYKKKVSSPHQsllsipgspfsprrnsrgsifsfrgrgrDAG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   549 QHLPYADDSNAVTPMSE-ENGAIIVPVyygNLGSRHSSYTSHQSRISyTSHGDLLGGMAVMGVSTMTKESKLRN-RNTRN 626
Cdd:pfam11933   81 SENDFADDENSTFEESEsRRGSLFVPR---RNGERRSSYTSQASRSS-RSHPGLPQNGKRNSTVDTTTESELRKrRSSSK 156

                   .
gi 320542214   627 Q 627
Cdd:pfam11933  157 Q 157
GPHH super family cl25190
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1805-1861 1.39e-06

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


The actual alignment was detected with superfamily member pfam16905:

Pssm-ID: 318993  Cd Length: 71  Bit Score: 49.53  E-value: 1.39e-06
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 320542214  1805 LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHK--PNK--YK-IISMDIPI 1861
Cdd:pfam16905    2 LGPHHLDEFVRAWAEYDPAATGRIHYTDMYLLLRHIEPPLGFGKkcPARvaYKrLIRMNMPV 63
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1231-1502 2.07e-64

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 222.53  E-value: 2.07e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1231 NKYFETAVITMILMSSLALALEDVHLPQRPiLQDILYYMDRIFTVIFFLEMLIKWLALGFKV-YFTNAWCWLDFVIVMVS 1309
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEP-LTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1310 LINFVASLVGAGGIqaFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFK 1389
Cdd:pfam00520   80 LISLVLSSVGSLSG--LRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1390 CEDMNgtklsheiipnrnacesenytwvNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREvdkqpiretNIYMYL 1469
Cdd:pfam00520  158 WENPD-----------------------NGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFWAYI 205
                          250       260       270
                   ....*....|....*....|....*....|...
gi 320542214  1470 YFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAG 1502
Cdd:pfam00520  206 YFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1552-1802 9.85e-54

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 191.71  E-value: 9.85e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1552 FDIIIMLFIGLNMFTMTLDRYDASD-TYNAVLDYLNAIFVVIFSSECLLKIFA--LRYHYFIEPWNLFDVVVVILSILGL 1628
Cdd:pfam00520    4 FELFILLLILLNTIFLALETYFQPEePLTTVLEILDYVFTGIFTLEMLLKIIAagFKKRYFRSPWNILDFVVVLPSLISL 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1629 VLSDIiekyfVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV--KE 1706
Cdd:pfam00520   84 VLSSV-----GSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKlkTW 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1707 KSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEacdppdndkgypgncgSATVGITFLLSYLVISFLIVINMY 1786
Cdd:pfam00520  159 ENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK----------------GEFWAYIYFVSFIILGGFLLLNLF 222
                          250
                   ....*....|....*.
gi 320542214  1787 IAVILENYSQATEDVQ 1802
Cdd:pfam00520  223 IAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
761-972 1.42e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 170.91  E-value: 1.42e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   761 DPFVELFITLCIVVNTMFMAMDHHDMNKE-MERVLKSGNYFFTATFAIEATMKLMAMSPKY-YFQEGWNIFDFIIVAL-- 836
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPsl 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   837 -SLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKd 915
Cdd:pfam00520   81 iSLVLSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE- 159
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 320542214   916 rfpDGDLPRWNFTDFMHSFMIVFRVLCGE-WIESMWDCM-YVGDVSCIPFFLATVVIGN 972
Cdd:pfam00520  160 ---NPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIdGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
141-425 1.65e-45

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 167.83  E-value: 1.65e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   141 HPLFSLFIITTILVNCILMIM--------PTTPTVESTEVIFTGIYTFESAVKVMARGFIlcpFTYLRDAWNWLDFVVIA 212
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALetyfqpeePLTTVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   213 LAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLtq 288
Cdd:pfam00520   78 PSLISLVLSsvgsLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   289 kcikkfpldGSWGnltdenwdyhnrnssnwysedegisfplcgnisgagqcdddyvclqgfgpNPNYGYTSFDSFGWAFL 368
Cdd:pfam00520  156 ---------KTWE--------------------------------------------------NPDNGRTNFDNFPNAFL 176
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 320542214   369 SAFRLMTQDFWEDLYQLVLRAAGP-WHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 425
Cdd:pfam00520  177 WLFQTMTTEGWGDIMYDTIDGKGEfWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELT 234
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1492-1544 1.08e-27

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 110.35  E-value: 1.08e-27
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 320542214 1492 DNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVF 1544
Cdd:cd13433     1 DNFNQLKKKYGGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
998-1227 6.58e-27

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 310839  Cd Length: 195  Bit Score: 112.42  E-value: 6.58e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   998 DNDTNKIAEAFNRIGRFKSWVKRNIAD-CFKLIR----------------NKLTNQISDQPsgkGVCRCISAEHGDNELE 1060
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRNLRDfCHRPCLrppppvkkplsslkaaRSKENHIANHT---ATGPEAPRELEDDHLD 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1061 LGHDeiladglikkgikeqTQLEVA--IGDGMeftihgdmknnkpkkSKyLNNATDDDTASINSYgshknrpfkDESHKG 1138
Cdd:pfam06512   78 FITN---------------PNLTVSvpIAEGE---------------SD-LENEEDDDEDSQSSD---------EEKSKQ 117
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1139 SAETMEGEEKRDASKEDLGLDEELdeegeceegPLDGDIIIHAHDEDILDeyPADCCPDSYYKKFPILAGDDDSPFWQGW 1218
Cdd:pfam06512  118 SQEQLQEELDDSSSSEGSTVDLQD---------PEEELEKIPEEAEELEE--PEDCFTEGCVRRFPCCAVDITKGPWKIW 186

                   ....*....
gi 320542214  1219 GNLRLKTFQ 1227
Cdd:pfam06512  187 WNLRKTCYR 195
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
504-627 2.08e-20

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


Pssm-ID: 314757  Cd Length: 164  Bit Score: 92.49  E-value: 2.08e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   504 NKEKMSIRSVEVESESY-------TIRNGRGRFGIPGSDRKPLVLSTYQ----------------------------DAQ 548
Cdd:pfam11933    1 RKKKKSEGEEKGDDEKFpksesddSIRRKGFRFSVDRLAYKKKVSSPHQsllsipgspfsprrnsrgsifsfrgrgrDAG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   549 QHLPYADDSNAVTPMSE-ENGAIIVPVyygNLGSRHSSYTSHQSRISyTSHGDLLGGMAVMGVSTMTKESKLRN-RNTRN 626
Cdd:pfam11933   81 SENDFADDENSTFEESEsRRGSLFVPR---RNGERRSSYTSQASRSS-RSHPGLPQNGKRNSTVDTTTESELRKrRSSSK 156

                   .
gi 320542214   627 Q 627
Cdd:pfam11933  157 Q 157
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1805-1861 1.39e-06

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 318993  Cd Length: 71  Bit Score: 49.53  E-value: 1.39e-06
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 320542214  1805 LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHK--PNK--YK-IISMDIPI 1861
Cdd:pfam16905    2 LGPHHLDEFVRAWAEYDPAATGRIHYTDMYLLLRHIEPPLGFGKkcPARvaYKrLIRMNMPV 63
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1231-1502 2.07e-64

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 222.53  E-value: 2.07e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1231 NKYFETAVITMILMSSLALALEDVHLPQRPiLQDILYYMDRIFTVIFFLEMLIKWLALGFKV-YFTNAWCWLDFVIVMVS 1309
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEP-LTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1310 LINFVASLVGAGGIqaFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFK 1389
Cdd:pfam00520   80 LISLVLSSVGSLSG--LRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1390 CEDMNgtklsheiipnrnacesenytwvNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREvdkqpiretNIYMYL 1469
Cdd:pfam00520  158 WENPD-----------------------NGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFWAYI 205
                          250       260       270
                   ....*....|....*....|....*....|...
gi 320542214  1470 YFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAG 1502
Cdd:pfam00520  206 YFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1552-1802 9.85e-54

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 191.71  E-value: 9.85e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1552 FDIIIMLFIGLNMFTMTLDRYDASD-TYNAVLDYLNAIFVVIFSSECLLKIFA--LRYHYFIEPWNLFDVVVVILSILGL 1628
Cdd:pfam00520    4 FELFILLLILLNTIFLALETYFQPEePLTTVLEILDYVFTGIFTLEMLLKIIAagFKKRYFRSPWNILDFVVVLPSLISL 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1629 VLSDIiekyfVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV--KE 1706
Cdd:pfam00520   84 VLSSV-----GSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKlkTW 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1707 KSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEacdppdndkgypgncgSATVGITFLLSYLVISFLIVINMY 1786
Cdd:pfam00520  159 ENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK----------------GEFWAYIYFVSFIILGGFLLLNLF 222
                          250
                   ....*....|....*.
gi 320542214  1787 IAVILENYSQATEDVQ 1802
Cdd:pfam00520  223 IAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
761-972 1.42e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 170.91  E-value: 1.42e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   761 DPFVELFITLCIVVNTMFMAMDHHDMNKE-MERVLKSGNYFFTATFAIEATMKLMAMSPKY-YFQEGWNIFDFIIVAL-- 836
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPsl 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   837 -SLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKd 915
Cdd:pfam00520   81 iSLVLSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE- 159
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 320542214   916 rfpDGDLPRWNFTDFMHSFMIVFRVLCGE-WIESMWDCM-YVGDVSCIPFFLATVVIGN 972
Cdd:pfam00520  160 ---NPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIdGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
141-425 1.65e-45

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 167.83  E-value: 1.65e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   141 HPLFSLFIITTILVNCILMIM--------PTTPTVESTEVIFTGIYTFESAVKVMARGFIlcpFTYLRDAWNWLDFVVIA 212
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALetyfqpeePLTTVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   213 LAYVTMGID----LGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLtq 288
Cdd:pfam00520   78 PSLISLVLSsvgsLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   289 kcikkfpldGSWGnltdenwdyhnrnssnwysedegisfplcgnisgagqcdddyvclqgfgpNPNYGYTSFDSFGWAFL 368
Cdd:pfam00520  156 ---------KTWE--------------------------------------------------NPDNGRTNFDNFPNAFL 176
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 320542214   369 SAFRLMTQDFWEDLYQLVLRAAGP-WHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQ 425
Cdd:pfam00520  177 WLFQTMTTEGWGDIMYDTIDGKGEfWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELT 234
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1492-1544 1.08e-27

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 110.35  E-value: 1.08e-27
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 320542214 1492 DNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVF 1544
Cdd:cd13433     1 DNFNQLKKKYGGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
998-1227 6.58e-27

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 310839  Cd Length: 195  Bit Score: 112.42  E-value: 6.58e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   998 DNDTNKIAEAFNRIGRFKSWVKRNIAD-CFKLIR----------------NKLTNQISDQPsgkGVCRCISAEHGDNELE 1060
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRNLRDfCHRPCLrppppvkkplsslkaaRSKENHIANHT---ATGPEAPRELEDDHLD 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1061 LGHDeiladglikkgikeqTQLEVA--IGDGMeftihgdmknnkpkkSKyLNNATDDDTASINSYgshknrpfkDESHKG 1138
Cdd:pfam06512   78 FITN---------------PNLTVSvpIAEGE---------------SD-LENEEDDDEDSQSSD---------EEKSKQ 117
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1139 SAETMEGEEKRDASKEDLGLDEELdeegeceegPLDGDIIIHAHDEDILDeyPADCCPDSYYKKFPILAGDDDSPFWQGW 1218
Cdd:pfam06512  118 SQEQLQEELDDSSSSEGSTVDLQD---------PEEELEKIPEEAEELEE--PEDCFTEGCVRRFPCCAVDITKGPWKIW 186

                   ....*....
gi 320542214  1219 GNLRLKTFQ 1227
Cdd:pfam06512  187 WNLRKTCYR 195
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
504-627 2.08e-20

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


Pssm-ID: 314757  Cd Length: 164  Bit Score: 92.49  E-value: 2.08e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   504 NKEKMSIRSVEVESESY-------TIRNGRGRFGIPGSDRKPLVLSTYQ----------------------------DAQ 548
Cdd:pfam11933    1 RKKKKSEGEEKGDDEKFpksesddSIRRKGFRFSVDRLAYKKKVSSPHQsllsipgspfsprrnsrgsifsfrgrgrDAG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   549 QHLPYADDSNAVTPMSE-ENGAIIVPVyygNLGSRHSSYTSHQSRISyTSHGDLLGGMAVMGVSTMTKESKLRN-RNTRN 626
Cdd:pfam11933   81 SENDFADDENSTFEESEsRRGSLFVPR---RNGERRSSYTSQASRSS-RSHPGLPQNGKRNSTVDTTTESELRKrRSSSK 156

                   .
gi 320542214   627 Q 627
Cdd:pfam11933  157 Q 157
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1566-1795 4.81e-09

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 285288  Cd Length: 426  Bit Score: 60.82  E-value: 4.81e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1566 TMTLDRYDASDTYNAVLDYLN-AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSdiIEKYFVSPTLL 1644
Cdd:pfam08016  197 SVKLLRYVTNRSLFILLCEVVfLVFFLYFVVAEILKIRYHRPHYLRSVWNLLDLAIVVLSVVLIVLN--IYRDFLADRLI 274
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1645 RVV-----------RVAKVGRVLRLVKGA-------KGIRTLLFA---------LAMSLPALFNICLLLFLVMFIFAIFG 1697
Cdd:pfam08016  275 KSVeaspvtfidfdRVAQLDNAYRIILAFllfltwvKLFKVLRFNktmslftktLSRALKDLAGFALMFVIFFFAYAQLG 354
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1698 MSFFMhvkeksgiNDVYNFKTFGQSMILLFQMstsagwdgVLDAIINEEACDppdndkgypgncGSATVGITFLLSYLVI 1777
Cdd:pfam08016  355 YLLFG--------TQVDNFSNFIKSILTLFRT--------ICGAFGYNEIFS------------GNRVLGPLLFLTLVFL 406
                          250
                   ....*....|....*...
gi 320542214  1778 SFLIVINMYIAVILENYS 1795
Cdd:pfam08016  407 VIFILLNLFLAIINDSYV 424
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1805-1861 1.39e-06

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 318993  Cd Length: 71  Bit Score: 49.53  E-value: 1.39e-06
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 320542214  1805 LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHK--PNK--YK-IISMDIPI 1861
Cdd:pfam16905    2 LGPHHLDEFVRAWAEYDPAATGRIHYTDMYLLLRHIEPPLGFGKkcPARvaYKrLIRMNMPV 63
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
849-943 4.38e-04

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 285288  Cd Length: 426  Bit Score: 44.65  E-value: 4.38e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   849 LSVLRSFRLLRVFKlakswpTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGkNYHdhkdrfpdgdlprWNFT 928
Cdd:pfam08016  307 LTWVKLFKVLRFNK------TMSLFTKTLSRALKDLAGFALMFVIFFFAYAQLGYLLFG-TQV-------------DNFS 366
                           90
                   ....*....|....*
gi 320542214   929 DFMHSFMIVFRVLCG 943
Cdd:pfam08016  367 NFIKSILTLFRTICG 381
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH