NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|31794259|ref|NP_856752|]
View 

serine/threonine-protein kinase transcriptional regulator [Mycobacterium bovis AF2122/97]

Protein Classification

serine/threonine-protein kinase PknK (domain architecture ID 11600220)

serine/threonine-protein kinase PknK functions as a transcriptional and translational regulator in a phosphorylation-dependent manner

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MalT COG2909
ATP-, maltotriose- and DNA-dependent transcriptional regulator MalT [Transcription];
333-1110 0e+00

ATP-, maltotriose- and DNA-dependent transcriptional regulator MalT [Transcription];


:

Pssm-ID: 225461  Cd Length: 894  Bit Score: 793.91  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  333 ATKYRPSVPTGSLVTRSRLTDILRAGGRRRLILIHAPSGFGKSTLAAQWREeLSRDGAAVAWLTIDNDDNNEVWFLSHLL 412
Cdd:COG2909    9 PSKLVRPVRPDNYVVRPRLLDRLRRANDYRLILISAPAGFGKTTLLAQWRE-LAADGAAVAWLSLDESDNDPARFLSYLI 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  413 ESIRRVRPTLAESLGHVLEEHGDDAGRYVLTSLIDEIHENDDRIAVVIDDWHRVSDSRTQAALGFLLDNGCHHLQLIVTS 492
Cdd:COG2909   88 AALQQATPTLGDEAQTLLQKHQYVSLESLLSSLLNELASYEGPLYLVLDDYHLISDPALHEALRFLLKHAPENLTLVVTS 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  493 WSRAGLPVGRLRIGDELAEIDSAALRFDTDEAAALLNDAGGLRLPRADVQALTTSTDGWAAALRLAALSLRGGGDATQLL 572
Cdd:COG2909  168 RSRPQLGLARLRLRDELLEIGSEELRFDTEEAAAFLNDRGSLPLDAADLKALYDRTEGWAAALQLIALALRNNTSAEQSL 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  573 RGLSGASDVIHEFLSENVLDTLEPELREFLLVASVTERTCGGLASALAGITNGRAMLEEAEHRGLFLQRTEDDPNWFRFH 652
Cdd:COG2909  248 RGLSGAASHLSDYLVEEVLDRLPPELRDFLLQTSVLSRFNDELCNALTGEENGQAMLEELERRGLFLQRLDDEGQWFRYH 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  653 QMFADFLHRRLERGGSHRVAELHRRASAWFAENGYLHEAVDHALAAGDPARAVDLVEQDETNLPEQSKMTTLLAIVQKLP 732
Cdd:COG2909  328 HLFAEFLRQRLQRELAARLKELHRAAAEWFAEHGLPSEAIDHALAAGDPEMAADLLEQLEWQLFNGSELSLLLAWLKALP 407
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  733 TSMVVSRARLQLAIAWANILLQRPAPATGALNRFETALG-----RAELPEATQADLRAEADVLRAVAEVFADRVERVDDL 807
Cdd:COG2909  408 AELLASTPRLVLLQAWLLASQHRLAEAETLIARLEHFLKapmhsRQGDLLAEFQALRAQVALNRGDPEEAEDLARLALVQ 487
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  808 LAEAMSRPDTLPPRVPGTAG-----NTAALAAICRFE----FAEVYPLLDWAAP-------------YQEMMGPFGTVYA 865
Cdd:COG2909  488 LPEAAYRSRIVALSVLGEAAhirgeLTQALALMQQAEqmarQHDVYHLALWSLLqqseileaqgqvaRAEQEKAFNLIRE 567
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  866 Q------------CLRGMAARNRLDIVAALQNFRTAFEVGTAVGAHSHAARLAGSLLAELLYETGDLAGAGRLMDESYLL 933
Cdd:COG2909  568 QhleqkprheflvRIRAQLLRAWLRLDLAEAEARLGIEVGSVYTPQPLLSRLALSMLAELEFLRGDLDKALAQLDELERL 647
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  934 GSEGG-AVDYLAARYVIGARVKAAQGDHEGAADRLSTGGDTAVQLG-LPRLAAR-INNERIRLGIALPAAVAADLLAPRT 1010
Cdd:COG2909  648 LLNGQyHVDYLAAAYKVKLILWLAQGDKELAAEWLLKSGDPDKANAhFPQLQWRlIAREQILLGILLEAELALDELASRL 727
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259 1011 IPRDNGIATMTAELDEDSAVRLLSAGDSADRDQACQRAGALA-AAIDGTrRPLAALQAQILHIETLAATGRESDARNELA 1089
Cdd:COG2909  728 TEDLNRNLRLLGLLYEGEAVKGQLALDLLDALQLRERTGFLRhFAIEGE-ARMAEQLRQLILLGELPELERHRLQRILRE 806
                        810       820
                 ....*....|....*....|..
gi 31794259 1090 PVATKCAELG-LSRLLVDAGLA 1110
Cdd:COG2909  807 ILQTQRQKFIhLDEEFVEGLLN 828
STKc_PknB_like cd14014
Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs ...
25-284 1.35e-85

Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


:

Pssm-ID: 270916  Cd Length: 260  Bit Score: 279.86  E-value: 1.35e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   25 GFDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDL--DRDNLERFLREQRAMGRLSgHPHIVTVLQVGVLaGGRPFIV 102
Cdd:cd14014    1 RYRLVRLLGRGGMGEVYRARDTLLGRPVAIKVLRPELaeDEEFRERFLREARALARLS-HPNIVRVYDVGED-DGRPYIV 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  103 MPYHAKNSLETLIRRHGPLDWRETLSIGVKLAGALEAAHRVGTLHRDVKPGNILLTDYGEPQLTDFGIARIAGG-FETAT 181
Cdd:cd14014   79 MEYVEGGSLADLLRERGPLPPREALRILAQIADALAAAHRAGIVHRDIKPANILLTEDGRVKLTDFGIARALGDsGLTQT 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  182 GVIAGSPAFTAPEVLEGASPTPASDVYSLGATLFCVLTGHAAYERRSGERVIAQFLRITSQPIPDLRKqGLPADVAAAIE 261
Cdd:cd14014  159 GSVLGTPAYMAPEQARGGPVDPRSDIYSLGVVLYELLTGRPPFDGDSPAAVLAKHLQEAPPPPSPLNP-DVPPALDAIIL 237
                        250       260
                 ....*....|....*....|...
gi 31794259  262 RAMARHPADRPATAADVGEELRD 284
Cdd:cd14014  238 RALAKDPEERPQSAAELLAALRA 260
 
Name Accession Description Interval E-value
MalT COG2909
ATP-, maltotriose- and DNA-dependent transcriptional regulator MalT [Transcription];
333-1110 0e+00

ATP-, maltotriose- and DNA-dependent transcriptional regulator MalT [Transcription];


Pssm-ID: 225461  Cd Length: 894  Bit Score: 793.91  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  333 ATKYRPSVPTGSLVTRSRLTDILRAGGRRRLILIHAPSGFGKSTLAAQWREeLSRDGAAVAWLTIDNDDNNEVWFLSHLL 412
Cdd:COG2909    9 PSKLVRPVRPDNYVVRPRLLDRLRRANDYRLILISAPAGFGKTTLLAQWRE-LAADGAAVAWLSLDESDNDPARFLSYLI 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  413 ESIRRVRPTLAESLGHVLEEHGDDAGRYVLTSLIDEIHENDDRIAVVIDDWHRVSDSRTQAALGFLLDNGCHHLQLIVTS 492
Cdd:COG2909   88 AALQQATPTLGDEAQTLLQKHQYVSLESLLSSLLNELASYEGPLYLVLDDYHLISDPALHEALRFLLKHAPENLTLVVTS 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  493 WSRAGLPVGRLRIGDELAEIDSAALRFDTDEAAALLNDAGGLRLPRADVQALTTSTDGWAAALRLAALSLRGGGDATQLL 572
Cdd:COG2909  168 RSRPQLGLARLRLRDELLEIGSEELRFDTEEAAAFLNDRGSLPLDAADLKALYDRTEGWAAALQLIALALRNNTSAEQSL 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  573 RGLSGASDVIHEFLSENVLDTLEPELREFLLVASVTERTCGGLASALAGITNGRAMLEEAEHRGLFLQRTEDDPNWFRFH 652
Cdd:COG2909  248 RGLSGAASHLSDYLVEEVLDRLPPELRDFLLQTSVLSRFNDELCNALTGEENGQAMLEELERRGLFLQRLDDEGQWFRYH 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  653 QMFADFLHRRLERGGSHRVAELHRRASAWFAENGYLHEAVDHALAAGDPARAVDLVEQDETNLPEQSKMTTLLAIVQKLP 732
Cdd:COG2909  328 HLFAEFLRQRLQRELAARLKELHRAAAEWFAEHGLPSEAIDHALAAGDPEMAADLLEQLEWQLFNGSELSLLLAWLKALP 407
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  733 TSMVVSRARLQLAIAWANILLQRPAPATGALNRFETALG-----RAELPEATQADLRAEADVLRAVAEVFADRVERVDDL 807
Cdd:COG2909  408 AELLASTPRLVLLQAWLLASQHRLAEAETLIARLEHFLKapmhsRQGDLLAEFQALRAQVALNRGDPEEAEDLARLALVQ 487
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  808 LAEAMSRPDTLPPRVPGTAG-----NTAALAAICRFE----FAEVYPLLDWAAP-------------YQEMMGPFGTVYA 865
Cdd:COG2909  488 LPEAAYRSRIVALSVLGEAAhirgeLTQALALMQQAEqmarQHDVYHLALWSLLqqseileaqgqvaRAEQEKAFNLIRE 567
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  866 Q------------CLRGMAARNRLDIVAALQNFRTAFEVGTAVGAHSHAARLAGSLLAELLYETGDLAGAGRLMDESYLL 933
Cdd:COG2909  568 QhleqkprheflvRIRAQLLRAWLRLDLAEAEARLGIEVGSVYTPQPLLSRLALSMLAELEFLRGDLDKALAQLDELERL 647
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  934 GSEGG-AVDYLAARYVIGARVKAAQGDHEGAADRLSTGGDTAVQLG-LPRLAAR-INNERIRLGIALPAAVAADLLAPRT 1010
Cdd:COG2909  648 LLNGQyHVDYLAAAYKVKLILWLAQGDKELAAEWLLKSGDPDKANAhFPQLQWRlIAREQILLGILLEAELALDELASRL 727
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259 1011 IPRDNGIATMTAELDEDSAVRLLSAGDSADRDQACQRAGALA-AAIDGTrRPLAALQAQILHIETLAATGRESDARNELA 1089
Cdd:COG2909  728 TEDLNRNLRLLGLLYEGEAVKGQLALDLLDALQLRERTGFLRhFAIEGE-ARMAEQLRQLILLGELPELERHRLQRILRE 806
                        810       820
                 ....*....|....*....|..
gi 31794259 1090 PVATKCAELG-LSRLLVDAGLA 1110
Cdd:COG2909  807 ILQTQRQKFIhLDEEFVEGLLN 828
STKc_PknB_like cd14014
Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs ...
25-284 1.35e-85

Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


Pssm-ID: 270916  Cd Length: 260  Bit Score: 279.86  E-value: 1.35e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   25 GFDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDL--DRDNLERFLREQRAMGRLSgHPHIVTVLQVGVLaGGRPFIV 102
Cdd:cd14014    1 RYRLVRLLGRGGMGEVYRARDTLLGRPVAIKVLRPELaeDEEFRERFLREARALARLS-HPNIVRVYDVGED-DGRPYIV 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  103 MPYHAKNSLETLIRRHGPLDWRETLSIGVKLAGALEAAHRVGTLHRDVKPGNILLTDYGEPQLTDFGIARIAGG-FETAT 181
Cdd:cd14014   79 MEYVEGGSLADLLRERGPLPPREALRILAQIADALAAAHRAGIVHRDIKPANILLTEDGRVKLTDFGIARALGDsGLTQT 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  182 GVIAGSPAFTAPEVLEGASPTPASDVYSLGATLFCVLTGHAAYERRSGERVIAQFLRITSQPIPDLRKqGLPADVAAAIE 261
Cdd:cd14014  159 GSVLGTPAYMAPEQARGGPVDPRSDIYSLGVVLYELLTGRPPFDGDSPAAVLAKHLQEAPPPPSPLNP-DVPPALDAIIL 237
                        250       260
                 ....*....|....*....|...
gi 31794259  262 RAMARHPADRPATAADVGEELRD 284
Cdd:cd14014  238 RALAKDPEERPQSAAELLAALRA 260
PRK04841 PRK04841
transcriptional regulator MalT; Provisional
337-820 7.59e-75

transcriptional regulator MalT; Provisional


Pssm-ID: 235315  Cd Length: 903  Bit Score: 267.20  E-value: 7.59e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   337 RPSVPTGSLVtRSRLTDILRAGGRRRLILIHAPSGFGKSTLAAQWreelSRDGAAVAWLTIDNDDNNEVWFLSHLLESIR 416
Cdd:PRK04841    9 RPVRLHNTVV-RERLLAKLSGANNYRLVLVTSPAGYGKTTLISQW----AAGKNNLGWYSLDESDNQPERFASYLIAALQ 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   417 RVRPTLAESLGHVLEEHGDDAGRYVLTSLIDEIHENDDRIAVVIDDWHRVSDSRTQAALGFLLDNGCHHLQLIVTSWSRA 496
Cdd:PRK04841   84 QATNGHCSKSEALAQKRQYASLSSLFAQLFIELADWHQPLYLVIDDYHLITNPEIHEAMRFFLRHQPENLTLVVLSRNLP 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   497 GLPVGRLRIGDELAEIDSAALRFDTDEAAALLNDAGGLRLPRADVQALTTSTDGWAAA-LRLAALSLRGGGDATQLLRGL 575
Cdd:PRK04841  164 PLGIANLRVRDQLLEIGSQQLAFDHQEAQQFFDQRLSSPIEAAESSRLCDDVEGWATAlQLIALSARQNNSSLHDSARRL 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   576 SG--ASDvIHEFLSENVLDTLEPELREFLLVASVTERTCGGLASALAGITNGRAMLEEAEHRGLFLQRTEDDPNWFRFHQ 653
Cdd:PRK04841  244 AGinASH-LSDYLVEEVLDNVDLETRHFLLRCSVLRSMNDALIVRVTGEENGQMRLEELERQGLFIQRMDDSGEWFRYHP 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   654 MFADFLHRRLERGGSHRVAELHRRASAWFAENGYLHEAVDHALAAGDPARAVDLVEQDETNLPEQSKMTTLLAIVQKLPT 733
Cdd:PRK04841  323 LFASFLRHRCQWELAQELPELHRAAAEAWLAQGFPSEAIHHALAAGDAQLLRDILLQHGWSLFNQGELSLLEECLNALPW 402
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   734 SMVVSRARLQLAIAWANILLQRPAPATGALNRFETALgrAELPEATQADLRAEADVLRavAEVfADRVERVDDLLAEAMS 813
Cdd:PRK04841  403 EVLLENPRLVLLQAWLAQSQHRYSEVNTLLARAEQEL--KDRNIELDGTLQAEFNALR--AQV-AINDGDPEEAERLAEL 477

                  ....*..
gi 31794259   814 RPDTLPP 820
Cdd:PRK04841  478 ALAELPL 484
S_TKc smart00220
Serine/Threonine protein kinases, catalytic domain; Phosphotransferases. Serine or ...
26-280 2.65e-50

Serine/Threonine protein kinases, catalytic domain; Phosphotransferases. Serine or threonine-specific kinase subfamily.


Pssm-ID: 214567  Cd Length: 254  Bit Score: 180.42  E-value: 2.65e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259      26 FDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDLDRDNLERFLREqRAMGRLSGHPHIVTVLQVgVLAGGRPFIVMPY 105
Cdd:smart00220    1 YEILEKLGEGSFGKVYLARDKKTGKLVAIKVIKKKKIKKDRERILRE-IKILKKLKHPNIVRLYDV-FEDEDKLYLVMEY 78
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259     106 HAKNSLETLIRRHGPLDWRETLSIGVKLAGALEAAHRVGTLHRDVKPGNILLTDYGEPQLTDFGIARIAGGFETATGVIa 185
Cdd:smart00220   79 CEGGDLFDLLKKRGRLSEDEARFYLRQILSALEYLHSKGIVHRDLKPENILLDEDGHVKLADFGLARQLDPGEKLTTFV- 157
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259     186 GSPAFTAPEVLEGASPTPASDVYSLGATLFCVLTGHAAYERRSGERVIAQFLRiTSQPIPDLRKQGLPADVAAAIERAMA 265
Cdd:smart00220  158 GTPEYMAPEVLLGKGYGKAVDIWSLGVILYELLTGKPPFPGDDQLLELFKKIG-KPKPPFPPPEWDISPEAKDLIRKLLV 236
                           250
                    ....*....|....*
gi 31794259     266 RHPADRPaTAADVGE 280
Cdd:smart00220  237 KDPEKRL-TAEEALQ 250
SPS1 COG0515
Serine/threonine protein kinase [Signal transduction mechanisms];
25-350 1.41e-44

Serine/threonine protein kinase [Signal transduction mechanisms];


Pssm-ID: 223589  Cd Length: 384  Bit Score: 168.00  E-value: 1.41e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   25 GFDNVEEIGRGGFGVVYRCVQPsldRAVAVKVLSTDL--DRDNLERFLREQRAMGRLSGHPHIVTVLQVGVlAGGRPFIV 102
Cdd:COG0515    1 SYRILRKLGEGSFGEVYLARDR---KLVALKVLAKKLesKSKEVERFLREIQILASLNHPPNIVKLYDFFQ-DEGSLYLV 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  103 MPYHAKNSLETLIR---RHGPLDWRETLSIGVKLAGALEAAHRVGTLHRDVKPGNILLT-DYGEPQLTDFGIARIAGGFE 178
Cdd:COG0515   77 MEYVDGGSLEDLLKkigRKGPLSESEALFILAQILSALEYLHSKGIIHRDIKPENILLDrDGRVVKLIDFGLAKLLPDPG 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  179 TA------TGVIAGSPAFTAPEVLEG---ASPTPASDVYSLGATLFCVLTGHAAYERRSGERVIAQFLRITSQ------- 242
Cdd:COG0515  157 STssipalPSTSVGTPGYMAPEVLLGlslAYASSSSDIWSLGITLYELLTGLPPFEGEKNSSATSQTLKIILElptpsla 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  243 -PIPDLRKQGLPADVAAAIERAMARHPADRPATAADVGEELRDVQRRNGVSVDEMPLPVELGVERRRSPEAHAAHRHTGG 321
Cdd:COG0515  237 sPLSPSNPELISKAASDLLKKLLAKDPKNRLSSSSDLSHDLLAHLKLKESDLSDLLKPDDSAPLRLSLPPSLEALISSLN 316
                        330       340
                 ....*....|....*....|....*....
gi 31794259  322 GTPTVPTPPTPATKYRPSVPTGSLVTRSR 350
Cdd:COG0515  317 SLAISGSDLKLDDSNFSKELAPNGVSSSP 345
Pkinase pfam00069
Protein kinase domain;
26-246 1.38e-42

Protein kinase domain;


Pssm-ID: 306557  Cd Length: 253  Bit Score: 158.53  E-value: 1.38e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259     26 FDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDLDRDN-LERFLREQRAMGRLSgHPHIVTVLQVgVLAGGRPFIVMP 104
Cdd:pfam00069    1 YEVLRKLGSGSFGTVYKAKHRDTGKIVAIKKIKKEKIKKKkDKNILREIKILKKLN-HPNIVRLYDA-FEDKDNLYLVLE 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259    105 YHAKNSLETLIRRHGPLDWRETLSIGVKLAGALEAAHRVGTLHRDVKPGNILLTDYGEPQLTDFGIARIAGGFETATgVI 184
Cdd:pfam00069   79 YVEGGSLFDLLSEKGAFSEREAKFIMKQILEGLEYLHSNGIIHRDLKPENILIDEDGNLKITDFGLARQLNSGSSLT-SF 157
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 31794259    185 AGSPAFTAPEVLEGASPTPASDVYSLGATLFCVLTGHAAYERRSGERVIAQFLRIT-SQPIPD 246
Cdd:pfam00069  158 VGTPWYMAPEVLRGNPYGPKVDVWSLGCILYELLTGKPPFPGINGNEIYEKIIDQDfDSPRPS 220
pknD PRK13184
serine/threonine-protein kinase; Reviewed
26-282 3.23e-26

serine/threonine-protein kinase; Reviewed


Pssm-ID: 183880  Cd Length: 932  Bit Score: 116.41  E-value: 3.23e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259    26 FDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDLDRDNL--ERFLREQRAMGRLSgHPHIVTVLQVgvLAGGRP-FIV 102
Cdd:PRK13184    4 YDIIRLIGKGGMGEVYLAYDPVCSRRVALKKIREDLSENPLlkKRFLREAKIAADLI-HPGIVPVYSI--CSDGDPvYYT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   103 MPYHAKNSLETLIRR-------HGPLDWRET----LSIGVKLAGALEAAHRVGTLHRDVKPGNILLTDYGEPQLTDFGIA 171
Cdd:PRK13184   81 MPYIEGYTLKSLLKSvwqkeslSKELAEKTSvgafLSIFHKICATIEYVHSKGVLHRDLKPDNILLGLFGEVVILDWGAA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   172 RIAGGFE------------------TATGVIAGSPAFTAPEVLEGASPTPASDVYSLGATLFCVLTGHAAYERRSGERVI 233
Cdd:PRK13184  161 IFKKLEEedlldidvdernicyssmTIPGKIVGTPDYMAPERLLGVPASESTDIYALGVILYQMLTLSFPYRRKKGRKIS 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*....
gi 31794259   234 AQFLRITSQPIPDLRKqgLPADVAAAIERAMARHPADRPATAADVGEEL 282
Cdd:PRK13184  241 YRDVILSPIEVAPYRE--IPPFLSQIAMKALAVDPAERYSSVQELKQDL 287
TOMM_kin_cyc TIGR03903
TOMM system kinase/cyclase fusion protein; This model represents proteins of 1350 in length, ...
51-286 1.75e-24

TOMM system kinase/cyclase fusion protein; This model represents proteins of 1350 in length, in multiple species of Burkholderia, in Acidovorax avenae subsp. citrulli AAC00-1 and Delftia acidovorans SPH-1, and in multiple copies in Sorangium cellulosum, in genomic neighborhoods that include a cyclodehydratase/docking scaffold fusion protein (TIGR03882) and a member of the thiazole/oxazole modified metabolite (TOMM) precursor family TIGR03795. It has a kinase domain in the N-terminal 300 amino acids, followed by a cyclase homology domain, followed by regions without named domain definitions. It is a probable bacteriocin-like metabolite biosynthesis protein. [Cellular processes, Toxin production and resistance]


Pssm-ID: 274846  Cd Length: 1266  Bit Score: 111.09  E-value: 1.75e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259     51 AVAVKVLSTDLDRDNLE--RFLREQRAMGRLSgHPHIVTVLQVGVLAGGRPFIVMPYHAKNSLETLIRRHGPLDWRETLS 128
Cdd:TIGR03903    5 EVAIKLLRTDAPEEEHQraRFRRETALCARLY-HPNIVALLDSGEAPPGLLFAVFEYVPGRTLREVLAADGALPAGETGR 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259    129 IGVKLAGALEAAHRVGTLHRDVKPGNILLTDYG---EPQLTDFGIARIAGGFE-------TATGVIAGSPAFTAPEVLEG 198
Cdd:TIGR03903   84 LMLQVLDALACAHNQGIVHRDLKPQNIMVSQTGvrpHAKVLDFGIGTLLPGVRdadvatlTRTTEVLGTPTYCAPEQLRG 163
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259    199 ASPTPASDVYSLGATLFCVLTGHAAYERRSGERVIAQFLRITSQPIPDLrKQGLPadVAAAIERAMARHPADRPATAADV 278
Cdd:TIGR03903  164 EPVTPNSDLYAWGLIFLECLTGQRVVQGASVAEILYQQLSPVDVSLPPW-IAGHP--LGQVLRKALNKDPRQRAASAPAL 240

                   ....*...
gi 31794259    279 GEELRDVQ 286
Cdd:TIGR03903  241 AERFRALE 248
AAA_16 pfam13191
AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the ...
348-490 1.93e-09

AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


Pssm-ID: 315782  Cd Length: 168  Bit Score: 58.32  E-value: 1.93e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259    348 RSRLTDILR--AGGRRRLILIHAPSGFGKSTLAAQWREELSRDGAAVAWLTIDNDDNNEVWFLSHLLESIRR-------- 417
Cdd:pfam13191    9 LEQLLDLLDrvRSGRPPLVLLTGESGTGKTTLLRELLRALEEDGGYVLRGKCDELLSTPALAQALTREGLLRqlldeeas 88
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259    418 -----VRPTLAESLGHVLEEHGDDAGRY--VLTSLIDEIHENDDRIAVVIDDWHRVsDSRTQAALGFLLDNGCHHLQLIV 490
Cdd:pfam13191   89 slleaWRAALLEALGPLGADAGEARERLldALLRLLDLLARDERPLVLVLDDLQWA-DEASLQLLAALLRLLESLLPLLV 167
 
Name Accession Description Interval E-value
MalT COG2909
ATP-, maltotriose- and DNA-dependent transcriptional regulator MalT [Transcription];
333-1110 0e+00

ATP-, maltotriose- and DNA-dependent transcriptional regulator MalT [Transcription];


Pssm-ID: 225461  Cd Length: 894  Bit Score: 793.91  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  333 ATKYRPSVPTGSLVTRSRLTDILRAGGRRRLILIHAPSGFGKSTLAAQWREeLSRDGAAVAWLTIDNDDNNEVWFLSHLL 412
Cdd:COG2909    9 PSKLVRPVRPDNYVVRPRLLDRLRRANDYRLILISAPAGFGKTTLLAQWRE-LAADGAAVAWLSLDESDNDPARFLSYLI 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  413 ESIRRVRPTLAESLGHVLEEHGDDAGRYVLTSLIDEIHENDDRIAVVIDDWHRVSDSRTQAALGFLLDNGCHHLQLIVTS 492
Cdd:COG2909   88 AALQQATPTLGDEAQTLLQKHQYVSLESLLSSLLNELASYEGPLYLVLDDYHLISDPALHEALRFLLKHAPENLTLVVTS 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  493 WSRAGLPVGRLRIGDELAEIDSAALRFDTDEAAALLNDAGGLRLPRADVQALTTSTDGWAAALRLAALSLRGGGDATQLL 572
Cdd:COG2909  168 RSRPQLGLARLRLRDELLEIGSEELRFDTEEAAAFLNDRGSLPLDAADLKALYDRTEGWAAALQLIALALRNNTSAEQSL 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  573 RGLSGASDVIHEFLSENVLDTLEPELREFLLVASVTERTCGGLASALAGITNGRAMLEEAEHRGLFLQRTEDDPNWFRFH 652
Cdd:COG2909  248 RGLSGAASHLSDYLVEEVLDRLPPELRDFLLQTSVLSRFNDELCNALTGEENGQAMLEELERRGLFLQRLDDEGQWFRYH 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  653 QMFADFLHRRLERGGSHRVAELHRRASAWFAENGYLHEAVDHALAAGDPARAVDLVEQDETNLPEQSKMTTLLAIVQKLP 732
Cdd:COG2909  328 HLFAEFLRQRLQRELAARLKELHRAAAEWFAEHGLPSEAIDHALAAGDPEMAADLLEQLEWQLFNGSELSLLLAWLKALP 407
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  733 TSMVVSRARLQLAIAWANILLQRPAPATGALNRFETALG-----RAELPEATQADLRAEADVLRAVAEVFADRVERVDDL 807
Cdd:COG2909  408 AELLASTPRLVLLQAWLLASQHRLAEAETLIARLEHFLKapmhsRQGDLLAEFQALRAQVALNRGDPEEAEDLARLALVQ 487
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  808 LAEAMSRPDTLPPRVPGTAG-----NTAALAAICRFE----FAEVYPLLDWAAP-------------YQEMMGPFGTVYA 865
Cdd:COG2909  488 LPEAAYRSRIVALSVLGEAAhirgeLTQALALMQQAEqmarQHDVYHLALWSLLqqseileaqgqvaRAEQEKAFNLIRE 567
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  866 Q------------CLRGMAARNRLDIVAALQNFRTAFEVGTAVGAHSHAARLAGSLLAELLYETGDLAGAGRLMDESYLL 933
Cdd:COG2909  568 QhleqkprheflvRIRAQLLRAWLRLDLAEAEARLGIEVGSVYTPQPLLSRLALSMLAELEFLRGDLDKALAQLDELERL 647
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  934 GSEGG-AVDYLAARYVIGARVKAAQGDHEGAADRLSTGGDTAVQLG-LPRLAAR-INNERIRLGIALPAAVAADLLAPRT 1010
Cdd:COG2909  648 LLNGQyHVDYLAAAYKVKLILWLAQGDKELAAEWLLKSGDPDKANAhFPQLQWRlIAREQILLGILLEAELALDELASRL 727
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259 1011 IPRDNGIATMTAELDEDSAVRLLSAGDSADRDQACQRAGALA-AAIDGTrRPLAALQAQILHIETLAATGRESDARNELA 1089
Cdd:COG2909  728 TEDLNRNLRLLGLLYEGEAVKGQLALDLLDALQLRERTGFLRhFAIEGE-ARMAEQLRQLILLGELPELERHRLQRILRE 806
                        810       820
                 ....*....|....*....|..
gi 31794259 1090 PVATKCAELG-LSRLLVDAGLA 1110
Cdd:COG2909  807 ILQTQRQKFIhLDEEFVEGLLN 828
STKc_PknB_like cd14014
Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs ...
25-284 1.35e-85

Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins; STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


Pssm-ID: 270916  Cd Length: 260  Bit Score: 279.86  E-value: 1.35e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   25 GFDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDL--DRDNLERFLREQRAMGRLSgHPHIVTVLQVGVLaGGRPFIV 102
Cdd:cd14014    1 RYRLVRLLGRGGMGEVYRARDTLLGRPVAIKVLRPELaeDEEFRERFLREARALARLS-HPNIVRVYDVGED-DGRPYIV 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  103 MPYHAKNSLETLIRRHGPLDWRETLSIGVKLAGALEAAHRVGTLHRDVKPGNILLTDYGEPQLTDFGIARIAGG-FETAT 181
Cdd:cd14014   79 MEYVEGGSLADLLRERGPLPPREALRILAQIADALAAAHRAGIVHRDIKPANILLTEDGRVKLTDFGIARALGDsGLTQT 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259  182 GVIAGSPAFTAPEVLEGASPTPASDVYSLGATLFCVLTGHAAYERRSGERVIAQFLRITSQPIPDLRKqGLPADVAAAIE 261
Cdd:cd14014  159 GSVLGTPAYMAPEQARGGPVDPRSDIYSLGVVLYELLTGRPPFDGDSPAAVLAKHLQEAPPPPSPLNP-DVPPALDAIIL 237
                        250       260
                 ....*....|....*....|...
gi 31794259  262 RAMARHPADRPATAADVGEELRD 284
Cdd:cd14014  238 RALAKDPEERPQSAAELLAALRA 260
PRK04841 PRK04841
transcriptional regulator MalT; Provisional
337-820 7.59e-75

transcriptional regulator MalT; Provisional


Pssm-ID: 235315  Cd Length: 903  Bit Score: 267.20  E-value: 7.59e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   337 RPSVPTGSLVtRSRLTDILRAGGRRRLILIHAPSGFGKSTLAAQWreelSRDGAAVAWLTIDNDDNNEVWFLSHLLESIR 416
Cdd:PRK04841    9 RPVRLHNTVV-RERLLAKLSGANNYRLVLVTSPAGYGKTTLISQW----AAGKNNLGWYSLDESDNQPERFASYLIAALQ 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   417 RVRPTLAESLGHVLEEHGDDAGRYVLTSLIDEIHENDDRIAVVIDDWHRVSDSRTQAALGFLLDNGCHHLQLIVTSWSRA 496
Cdd:PRK04841   84 QATNGHCSKSEALAQKRQYASLSSLFAQLFIELADWHQPLYLVIDDYHLITNPEIHEAMRFFLRHQPENLTLVVLSRNLP 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   497 GLPVGRLRIGDELAEIDSAALRFDTDEAAALLNDAGGLRLPRADVQALTTSTDGWAAA-LRLAALSLRGGGDATQLLRGL 575
Cdd:PRK04841  164 PLGIANLRVRDQLLEIGSQQLAFDHQEAQQFFDQRLSSPIEAAESSRLCDDVEGWATAlQLIALSARQNNSSLHDSARRL 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   576 SG--ASDvIHEFLSENVLDTLEPELREFLLVASVTERTCGGLASALAGITNGRAMLEEAEHRGLFLQRTEDDPNWFRFHQ 653
Cdd:PRK04841  244 AGinASH-LSDYLVEEVLDNVDLETRHFLLRCSVLRSMNDALIVRVTGEENGQMRLEELERQGLFIQRMDDSGEWFRYHP 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   654 MFADFLHRRLERGGSHRVAELHRRASAWFAENGYLHEAVDHALAAGDPARAVDLVEQDETNLPEQSKMTTLLAIVQKLPT 733
Cdd:PRK04841  323 LFASFLRHRCQWELAQELPELHRAAAEAWLAQGFPSEAIHHALAAGDAQLLRDILLQHGWSLFNQGELSLLEECLNALPW 402
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31794259   734 SMVVSRARLQLAIAWANILLQRPAPATGALNRFETALgrAELPEATQADLRAEADVLRavAEVfADRVERVDDLLAEAMS 813
Cdd:PRK04841  403 EVLLENPRLVLLQAWLAQSQHRYSEVNTLLARAEQEL--KDRNIELDGTLQAEFNALR--AQV-AINDGDPEEAERLAEL 477

                  ....*..
gi 31794259   814 RPDTLPP 820
Cdd:PRK04841  478 ALAELPL 484
S_TKc smart00220
Serine/Threonine protein kinases, catalytic domain; Phosphotransferases. Serine or ...
26-280 2.65e-50

Serine/Threonine protein kinases, catalytic domain; Phosphotransferases. Serine or threonine-specific kinase subfamily.


Pssm-ID: 214567  Cd Length: 254  Bit Score: 180.42  E-value: 2.65e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|