NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568071]
View 

Chain T, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 4 Of 4)

Protein Classification

50S ribosomal protein L19 (domain architecture ID 10012333)

50S ribosomal protein L19 is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rplS PRK05338
50S ribosomal protein L19; Provisional
6-119 4.96e-56

50S ribosomal protein L19; Provisional


:

Pssm-ID: 235418  Cd Length: 116  Bit Score: 174.13  E-value: 4.96e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071   6 LIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQK 85
Cdd:PRK05338   3 LIKEIEAEQLRKDIPEFRPGDTVRVHVKVVEGNKERIQAFEGVVIARRGRGLNETFTVRKISYGVGVERTFPLHSPRIDS 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 307568071  86 IDIVQRGRARRAKLYFIRNLSDREIRRKLRADRK 119
Cdd:PRK05338  83 IEVVRRGKVRRAKLYYLRELRGKAARIKERRDAK 116
 
Name Accession Description Interval E-value
rplS PRK05338
50S ribosomal protein L19; Provisional
6-119 4.96e-56

50S ribosomal protein L19; Provisional


Pssm-ID: 235418  Cd Length: 116  Bit Score: 174.13  E-value: 4.96e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071   6 LIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQK 85
Cdd:PRK05338   3 LIKEIEAEQLRKDIPEFRPGDTVRVHVKVVEGNKERIQAFEGVVIARRGRGLNETFTVRKISYGVGVERTFPLHSPRIDS 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 307568071  86 IDIVQRGRARRAKLYFIRNLSDREIRRKLRADRK 119
Cdd:PRK05338  83 IEVVRRGKVRRAKLYYLRELRGKAARIKERRDAK 116
Ribosomal_L19 pfam01245
Ribosomal protein L19;
6-113 1.87e-55

Ribosomal protein L19;


Pssm-ID: 307415  Cd Length: 111  Bit Score: 172.54  E-value: 1.87e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071    6 LIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQK 85
Cdd:pfam01245   2 LIKEIEKEQLKKDIPEFRPGDTVRVHVKIKEGNKERIQVFEGVVIARRGGGISETFTVRKISYGVGVERTFPLHSPLIEK 81
                          90       100
                  ....*....|....*....|....*...
gi 307568071   86 IDIVQRGRARRAKLYFIRNLSDREIRRK 113
Cdd:pfam01245  82 IEVVRRGKVRRAKLYYLRDLRGKAARIK 109
RplS COG0335
Ribosomal protein L19 [Translation, ribosomal structure and biogenesis];
5-113 4.52e-44

Ribosomal protein L19 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223412  Cd Length: 115  Bit Score: 143.51  E-value: 4.52e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071   5 ALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQ 84
Cdd:COG0335    4 PIIQQLEQEQIKKDIPSFRPGDTVRVHVKIVEGSKERVQAFEGVVIARRGRGISETFTVRKISYGVGVERVFPLHSPLIE 83
                         90       100
                 ....*....|....*....|....*....
gi 307568071  85 KIDIVQRGRARRAKLYFIRNLSDREIRRK 113
Cdd:COG0335   84 SIEVVRRGKVRRAKLYYLRERRGKAARIK 112
rplS_bact TIGR01024
ribosomal protein L19, bacterial type; This model describes bacterial ribosomoal protein L19 ...
4-115 3.28e-41

ribosomal protein L19, bacterial type; This model describes bacterial ribosomoal protein L19 and its chloroplast equivalent. Putative mitochondrial L19 are found in several species (but not Saccharomyces cerevisiae) and score between trusted and noise cutoffs. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 130096  Cd Length: 113  Bit Score: 136.29  E-value: 3.28e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071    4 GALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLI 83
Cdd:TIGR01024   1 QNLIKQIEQEQLKKDLPDFRVGDTVRVHVKIVEGKKERIQVFEGVVIARRGGGIGETFTVRKISYGVGVERIFPLHSPNI 80
                          90       100       110
                  ....*....|....*....|....*....|..
gi 307568071   84 QKIDIVQRGRARRAKLYFIRNLSDREIRRKLR 115
Cdd:TIGR01024  81 DSIEVVRRGKVRRAKLYYLRERRGKAARIKER 112
 
Name Accession Description Interval E-value
rplS PRK05338
50S ribosomal protein L19; Provisional
6-119 4.96e-56

50S ribosomal protein L19; Provisional


Pssm-ID: 235418  Cd Length: 116  Bit Score: 174.13  E-value: 4.96e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071   6 LIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQK 85
Cdd:PRK05338   3 LIKEIEAEQLRKDIPEFRPGDTVRVHVKVVEGNKERIQAFEGVVIARRGRGLNETFTVRKISYGVGVERTFPLHSPRIDS 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 307568071  86 IDIVQRGRARRAKLYFIRNLSDREIRRKLRADRK 119
Cdd:PRK05338  83 IEVVRRGKVRRAKLYYLRELRGKAARIKERRDAK 116
Ribosomal_L19 pfam01245
Ribosomal protein L19;
6-113 1.87e-55

Ribosomal protein L19;


Pssm-ID: 307415  Cd Length: 111  Bit Score: 172.54  E-value: 1.87e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071    6 LIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQK 85
Cdd:pfam01245   2 LIKEIEKEQLKKDIPEFRPGDTVRVHVKIKEGNKERIQVFEGVVIARRGGGISETFTVRKISYGVGVERTFPLHSPLIEK 81
                          90       100
                  ....*....|....*....|....*...
gi 307568071   86 IDIVQRGRARRAKLYFIRNLSDREIRRK 113
Cdd:pfam01245  82 IEVVRRGKVRRAKLYYLRDLRGKAARIK 109
RplS COG0335
Ribosomal protein L19 [Translation, ribosomal structure and biogenesis];
5-113 4.52e-44

Ribosomal protein L19 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223412  Cd Length: 115  Bit Score: 143.51  E-value: 4.52e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071   5 ALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQ 84
Cdd:COG0335    4 PIIQQLEQEQIKKDIPSFRPGDTVRVHVKIVEGSKERVQAFEGVVIARRGRGISETFTVRKISYGVGVERVFPLHSPLIE 83
                         90       100
                 ....*....|....*....|....*....
gi 307568071  85 KIDIVQRGRARRAKLYFIRNLSDREIRRK 113
Cdd:COG0335   84 SIEVVRRGKVRRAKLYYLRERRGKAARIK 112
rplS_bact TIGR01024
ribosomal protein L19, bacterial type; This model describes bacterial ribosomoal protein L19 ...
4-115 3.28e-41

ribosomal protein L19, bacterial type; This model describes bacterial ribosomoal protein L19 and its chloroplast equivalent. Putative mitochondrial L19 are found in several species (but not Saccharomyces cerevisiae) and score between trusted and noise cutoffs. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 130096  Cd Length: 113  Bit Score: 136.29  E-value: 3.28e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071    4 GALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLI 83
Cdd:TIGR01024   1 QNLIKQIEQEQLKKDLPDFRVGDTVRVHVKIVEGKKERIQVFEGVVIARRGGGIGETFTVRKISYGVGVERIFPLHSPNI 80
                          90       100       110
                  ....*....|....*....|....*....|..
gi 307568071   84 QKIDIVQRGRARRAKLYFIRNLSDREIRRKLR 115
Cdd:TIGR01024  81 DSIEVVRRGKVRRAKLYYLRERRGKAARIKER 112
rpl19 CHL00084
ribosomal protein L19
1-115 1.32e-36

ribosomal protein L19


Pssm-ID: 177023  Cd Length: 117  Bit Score: 124.66  E-value: 1.32e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568071   1 MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHS 80
Cdd:CHL00084   2 MKLQQLVKEIESEFLKKNLPKIRVGDTVKVGVLIQEGNKERVQFYEGTVIAKKNSGLNTTITVRKVFQGIGVERVFLLHS 81
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 307568071  81 PLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLR 115
Cdd:CHL00084  82 PKLASIEVLRRSKVRRAKLYYLRNRVGKAARLKQK 116
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH