NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568009]
View 

Chain P, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 2 Of 4)

Protein Classification

50S ribosomal protein L15 (domain architecture ID 10012488)

50S ribosomal protein L15 associates with 23S ribosomal RNA and is involved in 50S ribosome assembly

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rplO PRK05592
50S ribosomal protein L15; Reviewed
1-143 3.88e-54

50S ribosomal protein L15; Reviewed


:

Pssm-ID: 235523  Cd Length: 146  Bit Score: 170.66  E-value: 3.88e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009   1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGqvpgeIKRPRY 80
Cdd:PRK05592   1 MKLNELKPAPGSRKARKRVGRGIGSGLGKTAGRGHKGQKARSGGGV-RPGFEGGQMPLYRRLPKRGFTN-----IFRKEY 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 307568009  81 QGVNLKDLARFE--GEVTPELLVRAGLLKKGY-RLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:PRK05592  75 AVVNLGDLNKFEegTEVTLEALKAAGLIRKNIkGVKVLGNGElTKKLTVKAHKFSKSAKEAIEAAGG 141
 
Name Accession Description Interval E-value
rplO PRK05592
50S ribosomal protein L15; Reviewed
1-143 3.88e-54

50S ribosomal protein L15; Reviewed


Pssm-ID: 235523  Cd Length: 146  Bit Score: 170.66  E-value: 3.88e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009   1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGqvpgeIKRPRY 80
Cdd:PRK05592   1 MKLNELKPAPGSRKARKRVGRGIGSGLGKTAGRGHKGQKARSGGGV-RPGFEGGQMPLYRRLPKRGFTN-----IFRKEY 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 307568009  81 QGVNLKDLARFE--GEVTPELLVRAGLLKKGY-RLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:PRK05592  75 AVVNLGDLNKFEegTEVTLEALKAAGLIRKNIkGVKVLGNGElTKKLTVKAHKFSKSAKEAIEAAGG 141
rplO_bact TIGR01071
ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis ...
2-143 2.53e-35

ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273428  Cd Length: 145  Bit Score: 122.43  E-value: 2.53e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009    2 KLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGlKDPRRFEGGRSTTLMRLPKRGMQGQVpgeiKRPRYQ 81
Cdd:TIGR01071   1 KLHELKPAKGSKKRRKRVGRGIGSGLGKTSGRGHKGQKARSGG-KVRRGFEGGQMPLYRRLPKRGFSNKR----FKKEYA 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 307568009   82 GVNLKDLARFEG---EVTPELLVRAGLL-KKGYRLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:TIGR01071  76 EVNLGKLAKLFDngeVVTLETLKEKGLItKKIKFVKVLGNGKlTKPLTVKAHRVSKSAKAAIEAAGG 142
RplO COG0200
Ribosomal protein L15 [Translation, ribosomal structure and biogenesis];
1-149 3.02e-33

Ribosomal protein L15 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223278  Cd Length: 152  Bit Score: 116.98  E-value: 3.02e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009   1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMqgqVPGEIKRPRY 80
Cdd:COG0200    1 MRLNDLKPARGSKKTRKRVGRGIGSGLGKTGGRGHKGQKARSGHKWVRPGFEGGQMPLYRRLPKRGF---TNSKFKKVEY 77
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 307568009  81 QGVNLKDLARFE---GEVTPELLVRAGLLKKGYRL-KILGEGE---AKPLKVVAhAFSKSALEKLKAAGGEPVLLE 149
Cdd:COG0200   78 AVVNLGKLAELLpegEEVTLASLKAAGVIRKLKDLvKVLGNGKltkAVPVKVKA-KASKSAIEKIEAAGGKVELIE 152
Ribosomal_L27A pfam00828
Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A; This family includes higher eukaryotic ...
27-147 6.94e-31

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A; This family includes higher eukaryotic ribosomal 60S L27A, archaeal 50S L18e, prokaryotic 50S L15, fungal mitochondrial L10, plant L27A, mitochondrial L15 and chloroplast L18-3 proteins.


Pssm-ID: 307118  Cd Length: 127  Bit Score: 110.26  E-value: 6.94e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009   27 HGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGQvpgeIKRPRYQGVNLKDLARF----------EGEVT 96
Cdd:pfam00828   1 KGKTGGRGHKGQKSRSGGKK-RPGFEGGQMPLYRRLPKRGFRNL----KFRKEYPPVNLDKLQELidegrldgaaGKVID 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 307568009   97 PELLVRAGLLKKGYRLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGGEPVL 147
Cdd:pfam00828  76 LEALKEAGLKKKKDGVKVLGKGElTKKLTVKASKFSKSAIEKIEAAGGKVEL 127
 
Name Accession Description Interval E-value
rplO PRK05592
50S ribosomal protein L15; Reviewed
1-143 3.88e-54

50S ribosomal protein L15; Reviewed


Pssm-ID: 235523  Cd Length: 146  Bit Score: 170.66  E-value: 3.88e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009   1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGqvpgeIKRPRY 80
Cdd:PRK05592   1 MKLNELKPAPGSRKARKRVGRGIGSGLGKTAGRGHKGQKARSGGGV-RPGFEGGQMPLYRRLPKRGFTN-----IFRKEY 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 307568009  81 QGVNLKDLARFE--GEVTPELLVRAGLLKKGY-RLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:PRK05592  75 AVVNLGDLNKFEegTEVTLEALKAAGLIRKNIkGVKVLGNGElTKKLTVKAHKFSKSAKEAIEAAGG 141
rplO_bact TIGR01071
ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis ...
2-143 2.53e-35

ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273428  Cd Length: 145  Bit Score: 122.43  E-value: 2.53e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009    2 KLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGlKDPRRFEGGRSTTLMRLPKRGMQGQVpgeiKRPRYQ 81
Cdd:TIGR01071   1 KLHELKPAKGSKKRRKRVGRGIGSGLGKTSGRGHKGQKARSGG-KVRRGFEGGQMPLYRRLPKRGFSNKR----FKKEYA 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 307568009   82 GVNLKDLARFEG---EVTPELLVRAGLL-KKGYRLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:TIGR01071  76 EVNLGKLAKLFDngeVVTLETLKEKGLItKKIKFVKVLGNGKlTKPLTVKAHRVSKSAKAAIEAAGG 142
RplO COG0200
Ribosomal protein L15 [Translation, ribosomal structure and biogenesis];
1-149 3.02e-33

Ribosomal protein L15 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223278  Cd Length: 152  Bit Score: 116.98  E-value: 3.02e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009   1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMqgqVPGEIKRPRY 80
Cdd:COG0200    1 MRLNDLKPARGSKKTRKRVGRGIGSGLGKTGGRGHKGQKARSGHKWVRPGFEGGQMPLYRRLPKRGF---TNSKFKKVEY 77
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 307568009  81 QGVNLKDLARFE---GEVTPELLVRAGLLKKGYRL-KILGEGE---AKPLKVVAhAFSKSALEKLKAAGGEPVLLE 149
Cdd:COG0200   78 AVVNLGKLAELLpegEEVTLASLKAAGVIRKLKDLvKVLGNGKltkAVPVKVKA-KASKSAIEKIEAAGGKVELIE 152
Ribosomal_L27A pfam00828
Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A; This family includes higher eukaryotic ...
27-147 6.94e-31

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A; This family includes higher eukaryotic ribosomal 60S L27A, archaeal 50S L18e, prokaryotic 50S L15, fungal mitochondrial L10, plant L27A, mitochondrial L15 and chloroplast L18-3 proteins.


Pssm-ID: 307118  Cd Length: 127  Bit Score: 110.26  E-value: 6.94e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009   27 HGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGQvpgeIKRPRYQGVNLKDLARF----------EGEVT 96
Cdd:pfam00828   1 KGKTGGRGHKGQKSRSGGKK-RPGFEGGQMPLYRRLPKRGFRNL----KFRKEYPPVNLDKLQELidegrldgaaGKVID 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 307568009   97 PELLVRAGLLKKGYRLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGGEPVL 147
Cdd:pfam00828  76 LEALKEAGLKKKKDGVKVLGKGElTKKLTVKASKFSKSAIEKIEAAGGKVEL 127
PRK04005 PRK04005
50S ribosomal protein L18e; Provisional
74-149 7.24e-06

50S ribosomal protein L18e; Provisional


Pssm-ID: 235196  Cd Length: 111  Bit Score: 42.14  E-value: 7.24e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 307568009  74 EIKRPR--YQGVNLKDLARF--EGEVtpelLVRAGllkkgyrlKILGEGE-AKPLKVVAHAFSKSALEKLKAAGGEPVLL 148
Cdd:PRK04005  27 RLEKPRrrRAEVNLSKINRYakEGDT----VVVPG--------KVLGSGKlDHKVTVAALSFSETAKEKIEEAGGKALTI 94

                 .
gi 307568009 149 E 149
Cdd:PRK04005  95 E 95
RPL18A COG1727
Ribosomal protein L18E [Translation, ribosomal structure and biogenesis];
74-149 1.57e-04

Ribosomal protein L18E [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224641  Cd Length: 122  Bit Score: 38.85  E-value: 1.57e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 307568009  74 EIKRPRYQGVNLKDLARFEGEvtPELLVRAGllkkgyrlKILGEG-EAKPLKVVAHAFSKSALEKLKAAGGEPVLLE 149
Cdd:COG1727   40 EKPRRNRAEVNVSKINRYAKE--GDTVVVPG--------KVLGDGkLDKKVTVAALRFSKTAREKIEEAGGECLTLE 106
rpl15p PRK06419
50S ribosomal protein L15P; Reviewed
113-149 1.79e-04

50S ribosomal protein L15P; Reviewed


Pssm-ID: 235799  Cd Length: 148  Bit Score: 39.04  E-value: 1.79e-04
                         10        20        30
                 ....*....|....*....|....*....|....*...
gi 307568009 113 KILGEGE-AKPLKVVAHAFSKSALEKLKAAGGEPVLLE 149
Cdd:PRK06419 109 KVLGGGKvTRPLVIKADAFSEKAIEKIEAAGGEVVLSE 146
PTZ00160 PTZ00160
60S ribosomal protein L27a; Provisional
105-147 5.94e-04

60S ribosomal protein L27a; Provisional


Pssm-ID: 185489  Cd Length: 147  Bit Score: 37.69  E-value: 5.94e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
gi 307568009 105 LLKKGYrLKILGEGE--AKPLKVVAHAFSKSALEKLKAAGGEPVL 147
Cdd:PTZ00160 102 VTKAGY-FKVLGKGHlpKQPVIVKARYFSKKAEKKIKAVGGACVL 145
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH