NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307567995|pdb|2XG08| ]
View 

Chain 8, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 2 Of 4)

Protein Classification

50S ribosomal protein L35 (domain architecture ID 10011291)

50S ribosomal protein L35 is involved in signal peptide recognition

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rpmI PRK00172
50S ribosomal protein L35; Reviewed
1-64 2.05e-17

50S ribosomal protein L35; Reviewed


:

Pssm-ID: 234676  Cd Length: 65  Bit Score: 70.16  E-value: 2.05e-17
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
2XG08         1 MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:PRK00172  1 MPKMKTKSGAAKRFKVTGSGKVKRKHAGKRHILTKKSTKRKRQLRGTTVVSKADAKRVKRMLPY 64
 
Name Accession Description Interval E-value
rpmI PRK00172
50S ribosomal protein L35; Reviewed
1-64 2.05e-17

50S ribosomal protein L35; Reviewed


Pssm-ID: 234676  Cd Length: 65  Bit Score: 70.16  E-value: 2.05e-17
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
2XG08         1 MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:PRK00172  1 MPKMKTKSGAAKRFKVTGSGKVKRKHAGKRHILTKKSTKRKRQLRGTTVVSKADAKRVKRMLPY 64
rpmI_bact TIGR00001
ribosomal protein L35; This ribosomal protein is found in bacteria and organelles only. It is ...
2-64 1.06e-16

ribosomal protein L35; This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 272847  Cd Length: 63  Bit Score: 68.46  E-value: 1.06e-16
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
2XG08          2 PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:TIGR00001  1 PKMKTHKAAAKRFKITGSGKIKRKKAGKRHLLTKKSSKRKRQLRKKAVVSKGDLKRVKLLLPY 63
Ribosomal_L35p pfam01632
Ribosomal protein L35;
2-62 2.68e-14

Ribosomal protein L35;


Pssm-ID: 307659  Cd Length: 61  Bit Score: 62.02  E-value: 2.68e-14
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG08          2 PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLL 62
Cdd:pfam01632  1 PKMKTHKGAAKRFKVTGSGKIKRKKAGKRHLLTKKSTKRKRRLRKTVLVSKADAKRVKKLL 61
RpmI COG0291
Ribosomal protein L35 [Translation, ribosomal structure and biogenesis];
1-64 8.81e-13

Ribosomal protein L35 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223368  Cd Length: 65  Bit Score: 58.40  E-value: 8.81e-13
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....
2XG08        1 MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:COG0291  1 MPKMKTKKGAAKRFKITGTGKIKRKHAGKRHILTKKSTKRKRHLRKTAVVSKADLKRVKRLLLY 64
 
Name Accession Description Interval E-value
rpmI PRK00172
50S ribosomal protein L35; Reviewed
1-64 2.05e-17

50S ribosomal protein L35; Reviewed


Pssm-ID: 234676  Cd Length: 65  Bit Score: 70.16  E-value: 2.05e-17
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
2XG08         1 MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:PRK00172  1 MPKMKTKSGAAKRFKVTGSGKVKRKHAGKRHILTKKSTKRKRQLRGTTVVSKADAKRVKRMLPY 64
rpmI_bact TIGR00001
ribosomal protein L35; This ribosomal protein is found in bacteria and organelles only. It is ...
2-64 1.06e-16

ribosomal protein L35; This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 272847  Cd Length: 63  Bit Score: 68.46  E-value: 1.06e-16
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
2XG08          2 PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:TIGR00001  1 PKMKTHKAAAKRFKITGSGKIKRKKAGKRHLLTKKSSKRKRQLRKKAVVSKGDLKRVKLLLPY 63
Ribosomal_L35p pfam01632
Ribosomal protein L35;
2-62 2.68e-14

Ribosomal protein L35;


Pssm-ID: 307659  Cd Length: 61  Bit Score: 62.02  E-value: 2.68e-14
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG08          2 PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLL 62
Cdd:pfam01632  1 PKMKTHKGAAKRFKVTGSGKIKRKKAGKRHLLTKKSTKRKRRLRKTVLVSKADAKRVKKLL 61
RpmI COG0291
Ribosomal protein L35 [Translation, ribosomal structure and biogenesis];
1-64 8.81e-13

Ribosomal protein L35 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223368  Cd Length: 65  Bit Score: 58.40  E-value: 8.81e-13
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....
2XG08        1 MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:COG0291  1 MPKMKTKKGAAKRFKITGTGKIKRKHAGKRHILTKKSTKRKRHLRKTAVVSKADLKRVKRLLLY 64
rpl35 CHL00103
ribosomal protein L35
1-64 3.54e-07

ribosomal protein L35


Pssm-ID: 214367  Cd Length: 65  Bit Score: 43.15  E-value: 3.54e-07
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
2XG08         1 MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPY 64
Cdd:CHL00103  1 MPKLKTRKAAAKRYKKTGNGKFLRRKAFKSHLLQKKSSKQKRKLSQTVCVSKGDSKSIKLMLPY 64
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH