NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307567968|pdb|2XFZG| ]
View 

Chain G, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 1 Of 4)

Protein Classification

30S ribosomal protein S7 (domain architecture ID 10792463)

30S ribosomal protein S7 is an assembly initiator protein which participates in the assembly of the bacterial 30S ribosomal subunit

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK05302 PRK05302
30S ribosomal protein S7; Validated
1-156 4.49e-95

30S ribosomal protein S7; Validated


:

Pssm-ID: 235398  Cd Length: 156  Bit Score: 275.44  E-value: 4.49e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:PRK05302   1 MPRRRRAPKREVLPDPKYGSVLVTKFINKLMLDGKKSVAEKIVYGALDIIEEKTGKDPLEVFEKALENVKPVVEVKSRRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XFZG         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:PRK05302  81 GGATYQVPVEVRPERRQALAMRWLVEAARKRGEKTMAERLANELLDAANNRGAAVKKREDTHRMAEANKAFAHYRW 156
 
Name Accession Description Interval E-value
PRK05302 PRK05302
30S ribosomal protein S7; Validated
1-156 4.49e-95

30S ribosomal protein S7; Validated


Pssm-ID: 235398  Cd Length: 156  Bit Score: 275.44  E-value: 4.49e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:PRK05302   1 MPRRRRAPKREVLPDPKYGSVLVTKFINKLMLDGKKSVAEKIVYGALDIIEEKTGKDPLEVFEKALENVKPVVEVKSRRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XFZG         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:PRK05302  81 GGATYQVPVEVRPERRQALAMRWLVEAARKRGEKTMAERLANELLDAANNRGAAVKKREDTHRMAEANKAFAHYRW 156
uS7_Bacteria cd14869
Bacterial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an ...
12-149 1.34e-80

Bacterial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the translation process which is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. Prokaryotic RPS7 is lacking the variable N-terminal region of eukaryotic RPS7. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit which is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271248  Cd Length: 138  Bit Score: 238.12  E-value: 1.34e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        12 LQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEV 91
Cdd:cd14869   1 ILPDPKYNSVLVSKFINKLMKDGKKSVAEKIVYDALEIIKKKTGKDPLEVFEKALENVKPLVEVRSRRVGGATYQVPVEV 80
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
2XFZG        92 SPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:cd14869  81 RPERRQSLALRWIIEAARKRKEKSMAEKLAAELLDAANNTGAAVKKKEDTHKMAEANK 138
RpsG COG0049
Ribosomal protein S7 [Translation, ribosomal structure and biogenesis];
3-149 2.66e-77

Ribosomal protein S7 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223127  Cd Length: 148  Bit Score: 230.16  E-value: 2.66e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG         3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:COG0049   2 RRHTAGKREVLPDPKYNSVIVERLINKIMRDGKKSLAEKIVYGAFDIIEKKTGQNPLQVFEKAIENVKPREEVKSRRVGG 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XFZG        83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:COG0049  82 ATYQVPVEVRPRRRVALALRWIVEGARKRNEKTMAERLANELIDAANNTGAAIKKKEDTHRMAEANR 148
Ribosomal_S7 pfam00177
Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 ...
18-149 8.57e-77

Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 from eukaryotes.


Pssm-ID: 306646  Cd Length: 132  Bit Score: 228.02  E-value: 8.57e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG          18 YGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQ 97
Cdd:pfam00177   1 YNSPLVEKLINRLMRDGKKSLAERIVYGAFDIIEEKTGKNPLEVFEKALENVKPRVEVKSRRVGGATYQVPVEVRPERRV 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
2XFZG          98 SLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:pfam00177  81 ALALRWIIEAARKRNEKTMAERLANELIDAANGRGAAVKKKEETHRMAEANR 132
rpsG_bact TIGR01029
ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar ...
3-156 4.01e-73

ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar branch of the ribosomal protein S7 family (includes prokaroytic S7 and eukaryotic S5). The eukaryotic and archaeal branch is described by model TIGR01028. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273403  Cd Length: 154  Bit Score: 219.47  E-value: 4.01e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG           3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:TIGR01029   1 RKRKAEKRKIPPDPVYGSVLLNKFINRVMKDGKKSLAESIVYKAFERIAKKTGEDPLEVFEQALENVKPLVEVKSRRVGG 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
2XFZG          83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:TIGR01029  81 ATYQVPVEVRPSRRYALAIRWLIEAARKRGGKSMAERLANEILDAANNTGAAIKKREDTHRMAEANKAFAHYRW 154
 
Name Accession Description Interval E-value
PRK05302 PRK05302
30S ribosomal protein S7; Validated
1-156 4.49e-95

30S ribosomal protein S7; Validated


Pssm-ID: 235398  Cd Length: 156  Bit Score: 275.44  E-value: 4.49e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:PRK05302   1 MPRRRRAPKREVLPDPKYGSVLVTKFINKLMLDGKKSVAEKIVYGALDIIEEKTGKDPLEVFEKALENVKPVVEVKSRRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XFZG         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:PRK05302  81 GGATYQVPVEVRPERRQALAMRWLVEAARKRGEKTMAERLANELLDAANNRGAAVKKREDTHRMAEANKAFAHYRW 156
uS7_Bacteria cd14869
Bacterial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an ...
12-149 1.34e-80

Bacterial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the translation process which is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. Prokaryotic RPS7 is lacking the variable N-terminal region of eukaryotic RPS7. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit which is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271248  Cd Length: 138  Bit Score: 238.12  E-value: 1.34e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        12 LQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEV 91
Cdd:cd14869   1 ILPDPKYNSVLVSKFINKLMKDGKKSVAEKIVYDALEIIKKKTGKDPLEVFEKALENVKPLVEVRSRRVGGATYQVPVEV 80
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
2XFZG        92 SPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:cd14869  81 RPERRQSLALRWIIEAARKRKEKSMAEKLAAELLDAANNTGAAVKKKEDTHKMAEANK 138
RpsG COG0049
Ribosomal protein S7 [Translation, ribosomal structure and biogenesis];
3-149 2.66e-77

Ribosomal protein S7 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223127  Cd Length: 148  Bit Score: 230.16  E-value: 2.66e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG         3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:COG0049   2 RRHTAGKREVLPDPKYNSVIVERLINKIMRDGKKSLAEKIVYGAFDIIEKKTGQNPLQVFEKAIENVKPREEVKSRRVGG 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XFZG        83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:COG0049  82 ATYQVPVEVRPRRRVALALRWIVEGARKRNEKTMAERLANELIDAANNTGAAIKKKEDTHRMAEANR 148
Ribosomal_S7 pfam00177
Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 ...
18-149 8.57e-77

Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 from eukaryotes.


Pssm-ID: 306646  Cd Length: 132  Bit Score: 228.02  E-value: 8.57e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG          18 YGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQ 97
Cdd:pfam00177   1 YNSPLVEKLINRLMRDGKKSLAERIVYGAFDIIEEKTGKNPLEVFEKALENVKPRVEVKSRRVGGATYQVPVEVRPERRV 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
2XFZG          98 SLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:pfam00177  81 ALALRWIIEAARKRNEKTMAERLANELIDAANGRGAAVKKKEETHRMAEANR 132
rpsG_bact TIGR01029
ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar ...
3-156 4.01e-73

ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar branch of the ribosomal protein S7 family (includes prokaroytic S7 and eukaryotic S5). The eukaryotic and archaeal branch is described by model TIGR01028. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273403  Cd Length: 154  Bit Score: 219.47  E-value: 4.01e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG           3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:TIGR01029   1 RKRKAEKRKIPPDPVYGSVLLNKFINRVMKDGKKSLAESIVYKAFERIAKKTGEDPLEVFEQALENVKPLVEVKSRRVGG 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
2XFZG          83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:TIGR01029  81 ATYQVPVEVRPSRRYALAIRWLIEAARKRGGKSMAERLANEILDAANNTGAAIKKREDTHRMAEANKAFAHYRW 154
rps7 CHL00053
ribosomal protein S7
1-155 1.35e-65

ribosomal protein S7


Pssm-ID: 176994  Cd Length: 155  Bit Score: 200.50  E-value: 1.35e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:CHL00053   1 MSRRGTAKKRTAKPDPIYRNRLVNMLVNRILKSGKKSLAYRIVYRALKKIQQKTEKNPLSVLRQAIRNVTPDVEVKARRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2XFZG         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYR 155
Cdd:CHL00053  81 GGSTYQVPIEIGSTRGKALAIRWLLKASRKRSGRNMAFKLSSELVDAAKGSGNAIRKKEETHRMAEANRAFAHFR 155
uS7_Chloroplast cd14871
Chloroplast homolog of Ribosomal Protein S7; Chloroplast RPS7 has both general and specific ...
10-154 9.09e-60

Chloroplast homolog of Ribosomal Protein S7; Chloroplast RPS7 has both general and specific regulatory roles in chloroplast translation process. uS7, also known as Ribosomal protein (RP)S7, is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. The chloroplasts of plants and algae have bacterial ancestry, but it has adopted novel mechanisms in order to execute its roles within a eukaryotic cell. Chloroplast RPS7 is more homologous to bacterial RPS7 than other eukaryotic mitochondrial proteins. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The chloroplast translation regulation is more complex than in bacteria with additional RNA and chloroplast-unique proteins. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit. RPS7 is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271250  Cd Length: 146  Bit Score: 185.17  E-value: 9.09e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        10 RQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPM 89
Cdd:cd14871   2 RPIKPDPIYNSRLVNMLVNRILKSGKKSLAYRIVYEALKEIKQKTKQDPLEVLEQAIRNVTPLVEVKARRVGGSTYQVPV 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
2XFZG        90 EVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHY 154
Cdd:cd14871  82 EVRSERGTALAIRWLLKASRKRSGRSMASKLANEIIDAAKNTGNAIRKKEETHRMAEANKAFAHF 146
uS7 cd00323
Ribosomal protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the ...
20-149 1.26e-50

Ribosomal protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the translation process which is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit. RPS7 is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271245  Cd Length: 130  Bit Score: 161.27  E-value: 1.26e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        20 DVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSL 99
Cdd:cd00323   1 KLLLKKFINILMKDGKKSKAEKIFSKALKILKKKTKKNPLKLLVEAIENIKPLVEVRSIKKRGKVYQVPVPLSPNRQVSL 80
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|
2XFZG       100 ALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:cd00323  81 AIKWLLKAVRKRKETSFAERLANEILDASNNKGASIKKKDDLHKLAEANR 130
uS7_Mitochondria_Mammalian cd14870
Mammalian Mitochondrial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein ...
17-155 1.25e-44

Mammalian Mitochondrial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the translation process which is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. MRPS7 shows more homology to bacterial RPS7 than mitochondrial proteins from plants and fungi. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The ribosomes present in mammalian mitochondria have more proteins and low percentage of ribosomal RNA than bacterial ribosomes. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit. RPS7 is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271249  Cd Length: 199  Bit Score: 148.16  E-value: 1.25e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        17 VYGDVLVTAFINKIMRDGKKNLAARIFYDACKII---------------QEKTGQEPLKVFKQAVENVKPRMEVRSRRVG 81
Cdd:cd14870  45 VFYDPLVSKFINMMMKKGNKELAREIVEKTLENIkriqlekyhkatdeeKESIELNPLVIFHKAVENCKPLLGLTSVKRG 124
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2XFZG        82 GANYQVPMEVSPRRQQSLALRWLVQAANQRPER-RAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYR 155
Cdd:cd14870 125 GKTYQVPVPITPNRARFLAMKWLIEACREKKRKiRFPEKLARELLDASNNQGKVVKKKQELHKQCEANRAYAHYR 199
uS7_plant cd15484
plant ribosomal protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part ...
26-156 9.46e-36

plant ribosomal protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the translation process which is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit. RPS7 is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271251  Cd Length: 147  Bit Score: 123.65  E-value: 9.46e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        26 FINKIMRDGKKNLAARIFYDACKIIQEKTGQE---PLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALR 102
Cdd:cd15484   7 FVNFLMKKGKKTKARTILFKTFHLLKQKQSAQtedVLVILVTAVENVKPSFEVRKVRIAGTTQLIPAALSPNKQETLAIR 86
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG       103 WLVQAANQRPERRAAVRI------AHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:cd15484  87 WILEAAKKKQRKQSKKRYsfayclADEILDASKKQGKARQKRDELHKLAEANRSLAHYRW 146
uS7_Mitochondria_Fungi cd14868
Fungal Mitochondrial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP) ...
20-149 2.21e-33

Fungal Mitochondrial homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the translation process which is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. Fungal and plants mitochondrial RPS7 shows less homology to the mammalian than to bacterial RPS7. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit. RPS7 is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271247  Cd Length: 151  Bit Score: 117.67  E-value: 2.21e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        20 DVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSL 99
Cdd:cd14868  22 DPLLEQLTNLIMKHGKKAKAQRIVSRALLHIHTLTRADPLPLLRQAIDSAAPLVKIKSQKKGAKNVQVPVPLNERQRRRK 101
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|
2XFZG       100 ALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:cd14868 102 AIKWILEASDKRPGKSFSERLAEEIIAVVEGTSSALEKKEQVHKLAVANR 151
uS7_Eukaryote cd14867
Eukaryota homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an ...
22-149 3.60e-27

Eukaryota homolog of Ribosomal Protein S7; uS7, also known as Ribosomal protein (RP)S7, is an important part of the translation process which is universally present in the small subunit of prokaryotic and eukaryotic ribosomes. Eukaryotic RPS7 (also named RPS5) have variable N-terminal regions that affect the efficiency of initiation translation process by impacting small ribosomal subunit to function. The ribosome small subunit is one of the two subunits of ribosome organelles that use mRNA as a template for protein synthesis in a process called translation. The small subunits of bacteria and eukaryotes have the same shape of head, body, platform, beak, and shoulder. RPS7 is located at the head of the small subunit which is a primary ribosomal RNA (rRNA) binding protein that assists in rRNA folding and the binding of other proteins during small subunit assembly in all species. RPS7 is also involved in the formation of the mRNA exit channel at the interface of the large and small subunits. Some ribosomal proteins have extra ribosomal functions in cell differentiation and apoptosis.


Pssm-ID: 271246  Cd Length: 185  Bit Score: 102.25  E-value: 3.60e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG        22 LVTAFINKIMR----DGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQ 97
Cdd:cd14867  49 IVERLINSLMMhgrnTGKKLMAYRIVKHAFEIIHLLTGKNPIQVLVDAIENSGPREDTTRIGYGGTVRRQAVDVSPLRRV 128
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
2XFZG        98 SLALRWLVQAAnqrpeRRAAVR--------IAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:cd14867 129 NQALRLIATGA-----REAAFRniksiaecLADELINAAKGssNSYAIKKKDELERVAKSNR 185
PRK04027 PRK04027
30S ribosomal protein S7P; Reviewed
23-149 7.95e-27

30S ribosomal protein S7P; Reviewed


Pssm-ID: 235204  Cd Length: 195  Bit Score: 101.52  E-value: 7.95e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG         23 VTAFINKIMRD----GKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQS 98
Cdd:PRK04027  60 VERLINKLMRTerntGKKQKAYNIVKEAFEIIEKRTKQNPIQVLVDAIENAAPREETTRIKYGGISYPKAVDVSPQRRVD 139
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
2XFZG         99 LALRWLVQAANQ---RPERRAAVRIAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:PRK04027 140 LALRFIAEGARQasfKNKKSIEEALAEEIIAAANNdpKSYAVRKKEEIERVAKSAR 195
uS7_euk_arch TIGR01028
ribosomal protein uS7, eukaryotic/archaeal; This model describes the members from the ...
22-149 2.76e-21

ribosomal protein uS7, eukaryotic/archaeal; This model describes the members from the eukaryotic cytosol and the Archaea of the family that includes ribosomal protein uS7 (previously S5 in yeast and human). A separate model describes bacterial and organellar S7. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273402  Cd Length: 186  Bit Score: 86.75  E-value: 2.76e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG          22 LVTAFINKIMR----DGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQ 97
Cdd:TIGR01028  50 IVERLINKVMRsgrnNGKKLKAYRIVKEAFEIIEKRTKKNPIQVLVDAIENAGPREDTTRVGYGGIAYRQAVDISPLRRV 129
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
2XFZG          98 SLALRWLVQAANQ---RPERRAAVRIAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:TIGR01028 130 DQALRNIALGAREaafRNKKSIAECLAEEIILAANGdsKSYAIKKKEELERVAKSAR 186
PTZ00091 PTZ00091
40S ribosomal protein S5; Provisional
34-149 1.68e-14

40S ribosomal protein S5; Provisional


Pssm-ID: 185439  Cd Length: 193  Bit Score: 67.87  E-value: 1.68e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZG         34 GKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEvrSRRVG--GANYQVPMEVSPRRQQSLALRWLVQAAnqr 111
Cdd:PTZ00091  73 GKKLLAVRIVKHAFEIIHLLTDKNPLQVLVDAVQNGGPRED--STRVGsgGVVRRQAVDVSPLRRVNQAIYLICKGA--- 147
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
2XFZG        112 peRRAAVR--------IAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:PTZ00091 148 --REAAFRniktiaecLADEIINASKEssNSYAIKKKDEVERVAKANR 193
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH