NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|30061333|ref|NP_835737|]
View 

protein Wnt-10b precursor [Danio rerio]

Protein Classification

wnt domain-containing protein (domain architecture ID 10443547)

wnt domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
50-427 9.04e-149

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


:

Pssm-ID: 306592  Cd Length: 304  Bit Score: 428.88  E-value: 9.04e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    50 RLAGLTKKQMRLCVRSPDVTASALQGIQVAIHECQHQLRDQRWNCSSLENHGKLPHQsaILNRGFRESAFSLSLLAAGVV 129
Cdd:pfam00110   1 RLPGLSRRQRRLCRRNPDVMASIAEGARLAISECQHQFRNRRWNCSTLEDRNAVFGK--VLKRGTRETAFVYAISSAGVV 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   130 HSVASACSLGKLRGCGCEAKRRLDDDkirlkltqlqlqtfqrsgvslagagentpelsslhgslpanlhsshpmsllkpl 209
Cdd:pfam00110  79 HAVTRACSSGELTSCGCDRSPRGRSP------------------------------------------------------ 104
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   210 pdevtmlQDTWEWGGCSHDIRFGVRFSRDWLDSRG-SPRDIHARTRIHNNRVGRQVVTDNMRRKCKCHGTSGSCQFKTCW 288
Cdd:pfam00110 105 -------GEDWEWGGCSDNIDYGMRFSRKFLDARErKGRDARALMNLHNNEAGRKAVKKNMRRECKCHGVSGSCSVKTCW 177
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   289 YVSPEFRLVGSLLREKFLTAIFINsqNKNNGVFNsrtggstgsdPLRGQRRRSISRELVYFEKSPDFCDREPAVDSLGTQ 368
Cdd:pfam00110 178 KQLPDFREVGDRLKEKYDGAVKVV--NNRGTRLR----------PRNSRFKPPTKTDLVYLEKSPDYCERDPKLGSLGTQ 245
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 30061333   369 GRICNKSSPGMDGCGSLCCGRGHNILKQARSERCHCRFHWCCYVLCEECKVTEWVNVCK 427
Cdd:pfam00110 246 GRECNKTSTGPDGCDLLCCGRGYNTRTVTRTERCNCKFHWCCYVKCKTCTRTVEVHTCK 304
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
50-427 9.04e-149

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 306592  Cd Length: 304  Bit Score: 428.88  E-value: 9.04e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    50 RLAGLTKKQMRLCVRSPDVTASALQGIQVAIHECQHQLRDQRWNCSSLENHGKLPHQsaILNRGFRESAFSLSLLAAGVV 129
Cdd:pfam00110   1 RLPGLSRRQRRLCRRNPDVMASIAEGARLAISECQHQFRNRRWNCSTLEDRNAVFGK--VLKRGTRETAFVYAISSAGVV 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   130 HSVASACSLGKLRGCGCEAKRRLDDDkirlkltqlqlqtfqrsgvslagagentpelsslhgslpanlhsshpmsllkpl 209
Cdd:pfam00110  79 HAVTRACSSGELTSCGCDRSPRGRSP------------------------------------------------------ 104
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   210 pdevtmlQDTWEWGGCSHDIRFGVRFSRDWLDSRG-SPRDIHARTRIHNNRVGRQVVTDNMRRKCKCHGTSGSCQFKTCW 288
Cdd:pfam00110 105 -------GEDWEWGGCSDNIDYGMRFSRKFLDARErKGRDARALMNLHNNEAGRKAVKKNMRRECKCHGVSGSCSVKTCW 177
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   289 YVSPEFRLVGSLLREKFLTAIFINsqNKNNGVFNsrtggstgsdPLRGQRRRSISRELVYFEKSPDFCDREPAVDSLGTQ 368
Cdd:pfam00110 178 KQLPDFREVGDRLKEKYDGAVKVV--NNRGTRLR----------PRNSRFKPPTKTDLVYLEKSPDYCERDPKLGSLGTQ 245
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 30061333   369 GRICNKSSPGMDGCGSLCCGRGHNILKQARSERCHCRFHWCCYVLCEECKVTEWVNVCK 427
Cdd:pfam00110 246 GRECNKTSTGPDGCDLLCCGRGYNTRTVTRTERCNCKFHWCCYVKCKTCTRTVEVHTCK 304
WNT1 smart00097
found in Wnt-1;
51-427 1.18e-112

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 336.60  E-value: 1.18e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333     51 LAGLTKKQMRLCVRSPDVTASALQGIQVAIHECQHQLRDQRWNCSSLENHgklPHQSAILNRGFRESAFSLSLLAAGVVH 130
Cdd:smart00097   2 LPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLDNA---SVFGKVLRQGTRETAFVYAISSAGVAH 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    131 SVASACSLGKLRGCGCEAKRRldddkirlkltqlqlqtfqrsgvslagaGENTPElsslhgslpanlhsshpmsllkplp 210
Cdd:smart00097  79 AVTRACSEGELDSCGCDYRKR----------------------------GRAGGR------------------------- 105
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    211 devtmlqdTWEWGGCSHDIRFGVRFSRDWLDSRGSPRDIHARTRIHNNRVGRQVVTDNMRRKCKCHGTSGSCQFKTCWYV 290
Cdd:smart00097 106 --------GWKWGGCSDNIDFGIRFSREFVDARERGKDARALMNLHNNEAGRLAVKKTMKRECKCHGVSGSCTVKTCWLQ 177
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    291 SPEFRLVGSLLREKFLTAIfinsqnknnGVFNSRTGGSTGSDPLRGQRRRSISRELVYFEKSPDFCDREPAVDSLGTQGR 370
Cdd:smart00097 178 LPDFRKVGDYLKEKYDGAS---------EVEVDKRGTNKAPVPKNSTFKPPTETDLVYLESSPDFCEKNPKTGSLGTQGR 248
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 30061333    371 ICNKSSPGMDGCGSLCCGRGHNILKQARSERCHCRFHWCCYVLCEECKVTEWVNVCK 427
Cdd:smart00097 249 QCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCNCKFHWCCYVKCKQCRETVEKHTCK 305
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
50-427 9.04e-149

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 306592  Cd Length: 304  Bit Score: 428.88  E-value: 9.04e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    50 RLAGLTKKQMRLCVRSPDVTASALQGIQVAIHECQHQLRDQRWNCSSLENHGKLPHQsaILNRGFRESAFSLSLLAAGVV 129
Cdd:pfam00110   1 RLPGLSRRQRRLCRRNPDVMASIAEGARLAISECQHQFRNRRWNCSTLEDRNAVFGK--VLKRGTRETAFVYAISSAGVV 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   130 HSVASACSLGKLRGCGCEAKRRLDDDkirlkltqlqlqtfqrsgvslagagentpelsslhgslpanlhsshpmsllkpl 209
Cdd:pfam00110  79 HAVTRACSSGELTSCGCDRSPRGRSP------------------------------------------------------ 104
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   210 pdevtmlQDTWEWGGCSHDIRFGVRFSRDWLDSRG-SPRDIHARTRIHNNRVGRQVVTDNMRRKCKCHGTSGSCQFKTCW 288
Cdd:pfam00110 105 -------GEDWEWGGCSDNIDYGMRFSRKFLDARErKGRDARALMNLHNNEAGRKAVKKNMRRECKCHGVSGSCSVKTCW 177
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333   289 YVSPEFRLVGSLLREKFLTAIFINsqNKNNGVFNsrtggstgsdPLRGQRRRSISRELVYFEKSPDFCDREPAVDSLGTQ 368
Cdd:pfam00110 178 KQLPDFREVGDRLKEKYDGAVKVV--NNRGTRLR----------PRNSRFKPPTKTDLVYLEKSPDYCERDPKLGSLGTQ 245
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 30061333   369 GRICNKSSPGMDGCGSLCCGRGHNILKQARSERCHCRFHWCCYVLCEECKVTEWVNVCK 427
Cdd:pfam00110 246 GRECNKTSTGPDGCDLLCCGRGYNTRTVTRTERCNCKFHWCCYVKCKTCTRTVEVHTCK 304
WNT1 smart00097
found in Wnt-1;
51-427 1.18e-112

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 336.60  E-value: 1.18e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333     51 LAGLTKKQMRLCVRSPDVTASALQGIQVAIHECQHQLRDQRWNCSSLENHgklPHQSAILNRGFRESAFSLSLLAAGVVH 130
Cdd:smart00097   2 LPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLDNA---SVFGKVLRQGTRETAFVYAISSAGVAH 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    131 SVASACSLGKLRGCGCEAKRRldddkirlkltqlqlqtfqrsgvslagaGENTPElsslhgslpanlhsshpmsllkplp 210
Cdd:smart00097  79 AVTRACSEGELDSCGCDYRKR----------------------------GRAGGR------------------------- 105
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    211 devtmlqdTWEWGGCSHDIRFGVRFSRDWLDSRGSPRDIHARTRIHNNRVGRQVVTDNMRRKCKCHGTSGSCQFKTCWYV 290
Cdd:smart00097 106 --------GWKWGGCSDNIDFGIRFSREFVDARERGKDARALMNLHNNEAGRLAVKKTMKRECKCHGVSGSCTVKTCWLQ 177
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061333    291 SPEFRLVGSLLREKFLTAIfinsqnknnGVFNSRTGGSTGSDPLRGQRRRSISRELVYFEKSPDFCDREPAVDSLGTQGR 370
Cdd:smart00097 178 LPDFRKVGDYLKEKYDGAS---------EVEVDKRGTNKAPVPKNSTFKPPTETDLVYLESSPDFCEKNPKTGSLGTQGR 248
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 30061333    371 ICNKSSPGMDGCGSLCCGRGHNILKQARSERCHCRFHWCCYVLCEECKVTEWVNVCK 427
Cdd:smart00097 249 QCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCNCKFHWCCYVKCKQCRETVEKHTCK 305
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH