NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|300244530|ref|NP_003610|]
View 

neurotrypsin precursor [Homo sapiens]

Protein Classification

SR and Tryp_SPc domain-containing protein (domain architecture ID 10639018)

protein containing domains KR, SR, and Tryp_SPc

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Tryp_SPc cd00190
Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens ...
631-872 2.14e-84

Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.


:

Pssm-ID: 238113  Cd Length: 232  Bit Score: 272.61  E-value: 2.14e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 631 IIGGKNSLRGGWPWQVSLRLKSshgdGRLLCGATLLSSCWVLTAAHCFkrYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQ 710
Cdd:cd00190    1 IVGGSEAKIGSFPWQVSLQYTG----GRHFCGGSLISPRWVLTAAHCV--YSSAPSNYTVRLGSHDLSSNEGGGQVIKVK 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 711 QIVIHREYRPDRSDYDIALVRLQGPeeqcARFSSHVLPACLPlWRERPQKTASNCYITGWGDT--GRAYSRTLQQAAIPL 788
Cdd:cd00190   75 KVIVHPNYNPSTYDNDIALLKLKRP----VTLSDNVRPICLP-SSGYNLPAGTTCTVSGWGRTseGGPLPDVLQEVNVPI 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 789 LPKRFCEERY--KGRFTGRMLCAGNlhEHKRVDSCQGDSGGPLMCERPGEsWVVYGVTSWGYGCGVKDSPGVYTKVSAFV 866
Cdd:cd00190  150 VSNAECKRAYsyGGTITDNMLCAGG--LEGGKDACQGDSGGPLVCNDNGR-GVLVGIVSWGSGCARPNYPGVYTRVSSYL 226

                 ....*.
gi 300244530 867 PWIKSV 872
Cdd:cd00190  227 DWIQKT 232
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
280-380 9.87e-45

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 158.27  E-value: 9.87e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   280 IRLAGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQC 359
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   360 PKSSWGEHNCGHKEDAGVSCT 380
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
500-599 2.32e-44

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 157.12  E-value: 2.32e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   500 VRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADC 579
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|
gi 300244530   580 IKQDIGRHNCRHSEDAGVIC 599
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
387-486 6.72e-40

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 144.41  E-value: 6.72e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   387 IRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASA-NHFEESTGPIWLDDVSCSGKETRFLQC 465
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGsAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   466 SRRQWGRHDCSHREDVSIACY 486
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
170-270 1.43e-29

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 115.13  E-value: 1.43e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   170 VRLRGGKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLC 249
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   250 EKDIWQGGVCPQKMAAAVTCS 270
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
KR smart00130
Kringle domain; Named after a Danish pastry. Found in several serine proteases and in ROR-like ...
99-164 1.93e-17

Kringle domain; Named after a Danish pastry. Found in several serine proteases and in ROR-like receptors. Can occur in up to 38 copies (in apolipoprotein(a)). Plasminogen-like kringles possess affinity for free lysine and lysine- containing peptides.


:

Pssm-ID: 214527  Cd Length: 83  Bit Score: 80.13  E-value: 1.93e-17
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 300244530    99 WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLrGQRHNFCRSPDG-AGRPWCFYGDARgkVDWGYCD 164
Cdd:smart00130  14 TVSVTKSGKPCQRWDSQTPHLHRFTPESFPDL-GLEENYCRNPDGdSEGPWCYTTDPN--VRWEYCD 77
 
Name Accession Description Interval E-value
Tryp_SPc cd00190
Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens ...
631-872 2.14e-84

Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.


Pssm-ID: 238113  Cd Length: 232  Bit Score: 272.61  E-value: 2.14e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 631 IIGGKNSLRGGWPWQVSLRLKSshgdGRLLCGATLLSSCWVLTAAHCFkrYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQ 710
Cdd:cd00190    1 IVGGSEAKIGSFPWQVSLQYTG----GRHFCGGSLISPRWVLTAAHCV--YSSAPSNYTVRLGSHDLSSNEGGGQVIKVK 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 711 QIVIHREYRPDRSDYDIALVRLQGPeeqcARFSSHVLPACLPlWRERPQKTASNCYITGWGDT--GRAYSRTLQQAAIPL 788
Cdd:cd00190   75 KVIVHPNYNPSTYDNDIALLKLKRP----VTLSDNVRPICLP-SSGYNLPAGTTCTVSGWGRTseGGPLPDVLQEVNVPI 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 789 LPKRFCEERY--KGRFTGRMLCAGNlhEHKRVDSCQGDSGGPLMCERPGEsWVVYGVTSWGYGCGVKDSPGVYTKVSAFV 866
Cdd:cd00190  150 VSNAECKRAYsyGGTITDNMLCAGG--LEGGKDACQGDSGGPLVCNDNGR-GVLVGIVSWGSGCARPNYPGVYTRVSSYL 226

                 ....*.
gi 300244530 867 PWIKSV 872
Cdd:cd00190  227 DWIQKT 232
Tryp_SPc smart00020
Trypsin-like serine protease; Many of these are synthesised as inactive precursor zymogens ...
630-869 5.86e-82

Trypsin-like serine protease; Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues.


Pssm-ID: 214473  Cd Length: 229  Bit Score: 266.08  E-value: 5.86e-82
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   630 RIIGGKNSLRGGWPWQVSLRLksshGDGRLLCGATLLSSCWVLTAAHCFkrYGNSTRSYAVRVGDyHTLVPEEFEEEIGV 709
Cdd:smart00020   1 RIVGGSEANIGSFPWQVSLQY----GGGRHFCGGSLISPRWVLTAAHCV--RGSDPSNIRVRLGS-HDLSSGEEGQVIKV 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   710 QQIVIHREYRPDRSDYDIALVRLQGPeeqcARFSSHVLPACLPlWRERPQKTASNCYITGWGDT---GRAYSRTLQQAAI 786
Cdd:smart00020  74 SKVIIHPNYNPSTYDNDIALLKLKEP----VTLSDNVRPICLP-SSNYNVPAGTTCTVSGWGRTsegAGSLPDTLQEVNV 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   787 PLLPKRFCEERYKGRF--TGRMLCAGNLHEHKrvDSCQGDSGGPLMCErpGESWVVYGVTSWGYGCGVKDSPGVYTKVSA 864
Cdd:smart00020 149 PIVSNATCRRAYSGGGaiTDNMLCAGGLEGGK--DACQGDSGGPLVCN--DGRWVLVGIVSWGSGCARPGKPGVYTRVSS 224

                   ....*
gi 300244530   865 FVPWI 869
Cdd:smart00020 225 YLDWI 229
Trypsin pfam00089
Trypsin;
631-869 2.10e-64

Trypsin;


Pssm-ID: 306573  Cd Length: 220  Bit Score: 217.31  E-value: 2.10e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  631 IIGGKNSLRGGWPWQVSLRLKSshgdGRLLCGATLLSSCWVLTAAHCFKrygnSTRSYAVRVGDYHTLVPEEFEEEIGVQ 710
Cdd:pfam00089   1 IVGGDEAQPGSFPWQVSLQLSS----GKHFCGGSLISENWVLTAAHCVS----NAKDVKVVLGAHNIVLREGGEQKFDVE 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  711 QIVIHREYRPDRSDYDIALVRLQGPeeqcARFSSHVLPACLPLWRERPQKTASnCYITGWGDTGRA-YSRTLQQAAIPLL 789
Cdd:pfam00089  73 KIIVHPNYNPDTLDNDIALLKLESP----VTLGDTVRPICLPDASSDLPVGTT-CTVSGWGNTKTLgPPDTLQEVTVPVV 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  790 PKRFCEERYKGRFTGRMLCAGNLhehKRVDSCQGDSGGPLMCERPgeswVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWI 869
Cdd:pfam00089 148 SRETCRSAYGGTVTDNMICAGAP---GGKDACQGDSGGPLVCSDG----ELIGIVSWGYGCASGNYPGVYTPVSSYLDWI 220
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
280-380 9.87e-45

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 158.27  E-value: 9.87e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   280 IRLAGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQC 359
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   360 PKSSWGEHNCGHKEDAGVSCT 380
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
500-599 2.32e-44

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 157.12  E-value: 2.32e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   500 VRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADC 579
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|
gi 300244530   580 IKQDIGRHNCRHSEDAGVIC 599
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
387-486 6.72e-40

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 144.41  E-value: 6.72e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   387 IRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASA-NHFEESTGPIWLDDVSCSGKETRFLQC 465
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGsAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   466 SRRQWGRHDCSHREDVSIACY 486
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
285-380 4.92e-39

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 142.11  E-value: 4.92e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  285 GSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAW-HQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSS 363
Cdd:pfam00530   1 GSSPCEGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGGAVSASsGCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRP 80
                          90
                  ....*....|....*..
gi 300244530  364 WGEHNCGHKEDAGVSCT 380
Cdd:pfam00530  81 WGQHNCSHSEDAGVICS 97
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
510-599 1.40e-36

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 135.17  E-value: 1.40e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  510 EGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARA-RTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHN 588
Cdd:pfam00530   6 EGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGGAVSAsSGCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRPWGQHN 85
                          90
                  ....*....|.
gi 300244530  589 CRHSEDAGVIC 599
Cdd:pfam00530  86 CSHSEDAGVIC 96
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
392-485 1.94e-35

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 131.71  E-value: 1.94e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  392 GKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQAS--ANHFEESTGPIWLDDVSCSGKETRFLQCSRRQ 469
Cdd:pfam00530   1 GSSPCEGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGGAVSASsgCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRP 80
                          90
                  ....*....|....*.
gi 300244530  470 WGRHDCSHREDVSIAC 485
Cdd:pfam00530  81 WGQHNCSHSEDAGVIC 96
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
170-270 1.43e-29

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 115.13  E-value: 1.43e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   170 VRLRGGKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLC 249
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   250 EKDIWQGGVCPQKMAAAVTCS 270
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
COG5640 COG5640
Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, ...
611-874 1.65e-29

Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227927  Cd Length: 413  Bit Score: 122.68  E-value: 1.65e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 611 NKESLSSVCGLRLLHRRQK-----------RIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFk 679
Cdd:COG5640    2 AFSALSCAFGLSLFLTLQPsaaqtadevssRIIGGSNANAGEYPSLVALVDRISDYVSGTFCGGSKLGGRYVLTAAHCA- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 680 rYGNSTRSyavrvGDYHTLVPE----EFEEEIGVQQIVIHREYRPDRSDYDIALVRLqgpeeqcARFSShvLPAcLPLWR 755
Cdd:COG5640   81 -DASSPIS-----SDVNRVVVDlndsSQAERGHVRTIYVHEFYSPGNLGNDIAVLEL-------ARAAS--LPR-VKITS 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 756 ERPQKTASNCYIT-------GWGDTGRAY-------SRTLQQAAIPLLPKRFCeERYKGR---------FTGrmLCAGNL 812
Cdd:COG5640  145 FDASDTFLNSVTTvspmtngTFGVTTPSDvprsspkGTILHEVAVLFVPLSTC-AQYKGCanasdgatgLTG--FCAGRP 221
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 300244530 813 hehkRVDSCQGDSGGPLMCErPGESWVVYGVTSWGYG-CGVKDSPGVYTKVSAFVPWIKSVTK 874
Cdd:COG5640  222 ----PKDACQGDSGGPIFHK-GEEGRVQRGVVSWGDGgCGGTLIPGVYTNVSNYQDWIAAMTN 279
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
175-270 5.82e-26

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 104.74  E-value: 5.82e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  175 GKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLG-GKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDI 253
Cdd:pfam00530   1 GSSPCEGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGgAVSASSGCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRP 80
                          90
                  ....*....|....*..
gi 300244530  254 WQGGVCPQKMAAAVTCS 270
Cdd:pfam00530  81 WGQHNCSHSEDAGVICS 97
KR smart00130
Kringle domain; Named after a Danish pastry. Found in several serine proteases and in ROR-like ...
99-164 1.93e-17

Kringle domain; Named after a Danish pastry. Found in several serine proteases and in ROR-like receptors. Can occur in up to 38 copies (in apolipoprotein(a)). Plasminogen-like kringles possess affinity for free lysine and lysine- containing peptides.


Pssm-ID: 214527  Cd Length: 83  Bit Score: 80.13  E-value: 1.93e-17
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 300244530    99 WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLrGQRHNFCRSPDG-AGRPWCFYGDARgkVDWGYCD 164
Cdd:smart00130  14 TVSVTKSGKPCQRWDSQTPHLHRFTPESFPDL-GLEENYCRNPDGdSEGPWCYTTDPN--VRWEYCD 77
KR cd00108
Kringle domain; Kringle domains are believed to play a role in binding mediators, such as ...
100-164 3.26e-10

Kringle domain; Kringle domains are believed to play a role in binding mediators, such as peptides, other proteins, membranes, or phospholipids. They are autonomous structural domains, found in a varying number of copies, in blood clotting and fibrinolytic proteins, some serine proteases and plasma proteins. Plasminogen-like kringles possess affinity for free lysine and lysine-containing peptides.


Pssm-ID: 238056  Cd Length: 83  Bit Score: 58.93  E-value: 3.26e-10
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 300244530 100 VSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGqRHNFCRSPDGA-GRPWCFYGDarGKVDWGYCD 164
Cdd:cd00108   16 VSTTKSGKPCQRWNSQLPHQHKFNPERFPEGLL-EENYCRNPDGDpEGPWCYTTD--PNVRWEYCD 78
Kringle pfam00051
Kringle domain; Kringle domains have been found in plasminogen, hepatocyte growth factors, ...
100-164 6.08e-09

Kringle domain; Kringle domains have been found in plasminogen, hepatocyte growth factors, prothrombin, and apolipoprotein A. Structure is disulfide-rich, nearly all-beta.


Pssm-ID: 306546  Cd Length: 79  Bit Score: 55.39  E-value: 6.08e-09
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 300244530  100 VSVTDFGAPCLRWAEVPPFLERSPPAS---WAQLRGqrhNFCRSPDGAGRPWCFYGDarGKVDWGYCD 164
Cdd:pfam00051  13 VSTTESGRPCQAWDSQTPHRHSKYTPEnfpAKGLGE---NYCRNPDGDERPWCYTTD--PRVRWEYCD 75
 
Name Accession Description Interval E-value
Tryp_SPc cd00190
Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens ...
631-872 2.14e-84

Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.


Pssm-ID: 238113  Cd Length: 232  Bit Score: 272.61  E-value: 2.14e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 631 IIGGKNSLRGGWPWQVSLRLKSshgdGRLLCGATLLSSCWVLTAAHCFkrYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQ 710
Cdd:cd00190    1 IVGGSEAKIGSFPWQVSLQYTG----GRHFCGGSLISPRWVLTAAHCV--YSSAPSNYTVRLGSHDLSSNEGGGQVIKVK 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 711 QIVIHREYRPDRSDYDIALVRLQGPeeqcARFSSHVLPACLPlWRERPQKTASNCYITGWGDT--GRAYSRTLQQAAIPL 788
Cdd:cd00190   75 KVIVHPNYNPSTYDNDIALLKLKRP----VTLSDNVRPICLP-SSGYNLPAGTTCTVSGWGRTseGGPLPDVLQEVNVPI 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 789 LPKRFCEERY--KGRFTGRMLCAGNlhEHKRVDSCQGDSGGPLMCERPGEsWVVYGVTSWGYGCGVKDSPGVYTKVSAFV 866
Cdd:cd00190  150 VSNAECKRAYsyGGTITDNMLCAGG--LEGGKDACQGDSGGPLVCNDNGR-GVLVGIVSWGSGCARPNYPGVYTRVSSYL 226

                 ....*.
gi 300244530 867 PWIKSV 872
Cdd:cd00190  227 DWIQKT 232
Tryp_SPc smart00020
Trypsin-like serine protease; Many of these are synthesised as inactive precursor zymogens ...
630-869 5.86e-82

Trypsin-like serine protease; Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues.


Pssm-ID: 214473  Cd Length: 229  Bit Score: 266.08  E-value: 5.86e-82
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   630 RIIGGKNSLRGGWPWQVSLRLksshGDGRLLCGATLLSSCWVLTAAHCFkrYGNSTRSYAVRVGDyHTLVPEEFEEEIGV 709
Cdd:smart00020   1 RIVGGSEANIGSFPWQVSLQY----GGGRHFCGGSLISPRWVLTAAHCV--RGSDPSNIRVRLGS-HDLSSGEEGQVIKV 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   710 QQIVIHREYRPDRSDYDIALVRLQGPeeqcARFSSHVLPACLPlWRERPQKTASNCYITGWGDT---GRAYSRTLQQAAI 786
Cdd:smart00020  74 SKVIIHPNYNPSTYDNDIALLKLKEP----VTLSDNVRPICLP-SSNYNVPAGTTCTVSGWGRTsegAGSLPDTLQEVNV 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   787 PLLPKRFCEERYKGRF--TGRMLCAGNLHEHKrvDSCQGDSGGPLMCErpGESWVVYGVTSWGYGCGVKDSPGVYTKVSA 864
Cdd:smart00020 149 PIVSNATCRRAYSGGGaiTDNMLCAGGLEGGK--DACQGDSGGPLVCN--DGRWVLVGIVSWGSGCARPGKPGVYTRVSS 224

                   ....*
gi 300244530   865 FVPWI 869
Cdd:smart00020 225 YLDWI 229
Trypsin pfam00089
Trypsin;
631-869 2.10e-64

Trypsin;


Pssm-ID: 306573  Cd Length: 220  Bit Score: 217.31  E-value: 2.10e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  631 IIGGKNSLRGGWPWQVSLRLKSshgdGRLLCGATLLSSCWVLTAAHCFKrygnSTRSYAVRVGDYHTLVPEEFEEEIGVQ 710
Cdd:pfam00089   1 IVGGDEAQPGSFPWQVSLQLSS----GKHFCGGSLISENWVLTAAHCVS----NAKDVKVVLGAHNIVLREGGEQKFDVE 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  711 QIVIHREYRPDRSDYDIALVRLQGPeeqcARFSSHVLPACLPLWRERPQKTASnCYITGWGDTGRA-YSRTLQQAAIPLL 789
Cdd:pfam00089  73 KIIVHPNYNPDTLDNDIALLKLESP----VTLGDTVRPICLPDASSDLPVGTT-CTVSGWGNTKTLgPPDTLQEVTVPVV 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  790 PKRFCEERYKGRFTGRMLCAGNLhehKRVDSCQGDSGGPLMCERPgeswVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWI 869
Cdd:pfam00089 148 SRETCRSAYGGTVTDNMICAGAP---GGKDACQGDSGGPLVCSDG----ELIGIVSWGYGCASGNYPGVYTPVSSYLDWI 220
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
280-380 9.87e-45

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 158.27  E-value: 9.87e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   280 IRLAGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQC 359
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   360 PKSSWGEHNCGHKEDAGVSCT 380
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
500-599 2.32e-44

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 157.12  E-value: 2.32e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   500 VRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADC 579
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|
gi 300244530   580 IKQDIGRHNCRHSEDAGVIC 599
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
387-486 6.72e-40

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 144.41  E-value: 6.72e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   387 IRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASA-NHFEESTGPIWLDDVSCSGKETRFLQC 465
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGsAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   466 SRRQWGRHDCSHREDVSIACY 486
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
285-380 4.92e-39

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 142.11  E-value: 4.92e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  285 GSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAW-HQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSS 363
Cdd:pfam00530   1 GSSPCEGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGGAVSASsGCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRP 80
                          90
                  ....*....|....*..
gi 300244530  364 WGEHNCGHKEDAGVSCT 380
Cdd:pfam00530  81 WGQHNCSHSEDAGVICS 97
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
510-599 1.40e-36

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 135.17  E-value: 1.40e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  510 EGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARA-RTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHN 588
Cdd:pfam00530   6 EGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGGAVSAsSGCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRPWGQHN 85
                          90
                  ....*....|.
gi 300244530  589 CRHSEDAGVIC 599
Cdd:pfam00530  86 CSHSEDAGVIC 96
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
392-485 1.94e-35

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 131.71  E-value: 1.94e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  392 GKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQAS--ANHFEESTGPIWLDDVSCSGKETRFLQCSRRQ 469
Cdd:pfam00530   1 GSSPCEGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGGAVSASsgCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRP 80
                          90
                  ....*....|....*.
gi 300244530  470 WGRHDCSHREDVSIAC 485
Cdd:pfam00530  81 WGQHNCSHSEDAGVIC 96
SR smart00202
Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR ...
170-270 1.43e-29

Scavenger receptor Cys-rich; The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 115.13  E-value: 1.43e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530   170 VRLRGGKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLC 249
Cdd:smart00202   1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                           90       100
                   ....*....|....*....|.
gi 300244530   250 EKDIWQGGVCPQKMAAAVTCS 270
Cdd:smart00202  81 PHSGWGSHNCSHGEDAGVVCS 101
COG5640 COG5640
Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, ...
611-874 1.65e-29

Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227927  Cd Length: 413  Bit Score: 122.68  E-value: 1.65e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 611 NKESLSSVCGLRLLHRRQK-----------RIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFk 679
Cdd:COG5640    2 AFSALSCAFGLSLFLTLQPsaaqtadevssRIIGGSNANAGEYPSLVALVDRISDYVSGTFCGGSKLGGRYVLTAAHCA- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 680 rYGNSTRSyavrvGDYHTLVPE----EFEEEIGVQQIVIHREYRPDRSDYDIALVRLqgpeeqcARFSShvLPAcLPLWR 755
Cdd:COG5640   81 -DASSPIS-----SDVNRVVVDlndsSQAERGHVRTIYVHEFYSPGNLGNDIAVLEL-------ARAAS--LPR-VKITS 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530 756 ERPQKTASNCYIT-------GWGDTGRAY-------SRTLQQAAIPLLPKRFCeERYKGR---------FTGrmLCAGNL 812
Cdd:COG5640  145 FDASDTFLNSVTTvspmtngTFGVTTPSDvprsspkGTILHEVAVLFVPLSTC-AQYKGCanasdgatgLTG--FCAGRP 221
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 300244530 813 hehkRVDSCQGDSGGPLMCErPGESWVVYGVTSWGYG-CGVKDSPGVYTKVSAFVPWIKSVTK 874
Cdd:COG5640  222 ----PKDACQGDSGGPIFHK-GEEGRVQRGVVSWGDGgCGGTLIPGVYTNVSNYQDWIAAMTN 279
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
175-270 5.82e-26

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 306915  Cd Length: 97  Bit Score: 104.74  E-value: 5.82e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300244530  175 GKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLG-GKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDI 253
Cdd:pfam00530   1 GSSPCEGRVEVYYNGQWGTVCDDGWDLEDANVVCRQLGCGgAVSASSGCSFFGPGTGPIWLDDVRCSGNETSLWQCPHRP 80
                          90
                  ....*....|....*..
gi 300244530  254 WQGGVCPQKMAAAVTCS 270
Cdd:pfam00530  81 WGQHNCSHSEDAGVICS 97
KR smart00130
Kringle domain; Named after a Danish pastry. Found in several serine proteases and in ROR-like ...
99-164 1.93e-17

Kringle domain; Named after a Danish pastry. Found in several serine proteases and in ROR-like receptors. Can occur in up to 38 copies (in apolipoprotein(a)). Plasminogen-like kringles possess affinity for free lysine and lysine- containing peptides.


Pssm-ID: 214527  Cd Length: 83  Bit Score: 80.13  E-value: 1.93e-17
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 300244530    99 WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLrGQRHNFCRSPDG-AGRPWCFYGDARgkVDWGYCD 164
Cdd:smart00130  14 TVSVTKSGKPCQRWDSQTPHLHRFTPESFPDL-GLEENYCRNPDGdSEGPWCYTTDPN--VRWEYCD 77
KR cd00108
Kringle domain; Kringle domains are believed to play a role in binding mediators, such as ...
100-164 3.26e-10

Kringle domain; Kringle domains are believed to play a role in binding mediators, such as peptides, other proteins, membranes, or phospholipids. They are autonomous structural domains, found in a varying number of copies, in blood clotting and fibrinolytic proteins, some serine proteases and plasma proteins. Plasminogen-like kringles possess affinity for free lysine and lysine-containing peptides.


Pssm-ID: 238056  Cd Length: 83  Bit Score: 58.93  E-value: 3.26e-10
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 300244530 100 VSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGqRHNFCRSPDGA-GRPWCFYGDarGKVDWGYCD 164
Cdd:cd00108   16 VSTTKSGKPCQRWNSQLPHQHKFNPERFPEGLL-EENYCRNPDGDpEGPWCYTTD--PNVRWEYCD 78
Kringle pfam00051
Kringle domain; Kringle domains have been found in plasminogen, hepatocyte growth factors, ...
100-164 6.08e-09

Kringle domain; Kringle domains have been found in plasminogen, hepatocyte growth factors, prothrombin, and apolipoprotein A. Structure is disulfide-rich, nearly all-beta.


Pssm-ID: 306546  Cd Length: 79  Bit Score: 55.39  E-value: 6.08e-09
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 300244530  100 VSVTDFGAPCLRWAEVPPFLERSPPAS---WAQLRGqrhNFCRSPDGAGRPWCFYGDarGKVDWGYCD 164
Cdd:pfam00051  13 VSTTESGRPCQAWDSQTPHRHSKYTPEnfpAKGLGE---NYCRNPDGDERPWCYTTD--PRVRWEYCD 75
SRCR_2 pfam15494
Scavenger receptor cysteine-rich domain; SRCR_2 is a scavenger receptor cysteine-rich domain ...
400-430 2.59e-03

Scavenger receptor cysteine-rich domain; SRCR_2 is a scavenger receptor cysteine-rich domain family found largely on vertebrate sequences up-stream of the trypsin-like transmembrane serine protease, Spinesin.


Pssm-ID: 317845  Cd Length: 99  Bit Score: 38.49  E-value: 2.59e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 300244530  400 LEVY--YRGQWGTVCDDGWTELNTYVVCRQLGF 430
Cdd:pfam15494   6 LQVYsrARKSWLPVCSDGWSPAYGKAACQQLGY 38
SRCR_2 pfam15494
Scavenger receptor cysteine-rich domain; SRCR_2 is a scavenger receptor cysteine-rich domain ...
514-543 6.35e-03

Scavenger receptor cysteine-rich domain; SRCR_2 is a scavenger receptor cysteine-rich domain family found largely on vertebrate sequences up-stream of the trypsin-like transmembrane serine protease, Spinesin.


Pssm-ID: 317845  Cd Length: 99  Bit Score: 37.34  E-value: 6.35e-03
                          10        20        30
                  ....*....|....*....|....*....|..
gi 300244530  514 EVFI--NGQWGTICDDGWTDKDAAVICRQLGY 543
Cdd:pfam15494   7 QVYSraRKSWLPVCSDGWSPAYGKAACQQLGY 38
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH