NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|30018745|ref|NP_830376|]
View 

methyl-accepting chemotaxis protein [Bacillus cereus ATCC 14579]

Protein Classification

dCache_1 and MCP_signal domain-containing protein (domain architecture ID 11622725)

protein containing domains Tar_Tsr_LBD, dCache_1, and MCP_signal

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
287-658 4.65e-69

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


:

Pssm-ID: 223910  Cd Length: 408  Bit Score: 233.73  E-value: 4.65e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 287 ISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNINTSASHVAASS 366
Cdd:COG0840  68 VAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGAS 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 367 EELTASMKQTSEATEQITQAIEQVSSGaeiqtkeveegatlLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQT 446
Cdd:COG0840 148 EEIAASATELSARADQQAESLEEVASA--------------IEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQA 213
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 447 VNQMQLIHESVsqsDKIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQS 526
Cdd:COG0840 214 VEQMQEIAEEL---AEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADS 290
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 527 STEIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQSFAEILKSTNDTVVQIDsmvdvakqmtvdakQVSASINE 606
Cdd:COG0840 291 AKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLIS--------------EIAAATEE 356
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 30018745 607 IAATIEENAASVQNIAGSSEEQLASVDEINAAAVHLSQMAEELQEMISKFKV 658
Cdd:COG0840 357 QTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
dCache_1 pfam02743
Cache domain; Double cache domain 1 covers the last three strands from the membrane distal ...
159-264 4.01e-08

Cache domain; Double cache domain 1 covers the last three strands from the membrane distal PAS-like domain, the first two strands of the membrane proximal domain, and the connecting elements between the two domains.


:

Pssm-ID: 308398  Cd Length: 195  Bit Score: 53.74  E-value: 4.01e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   159 TGNIVITLAKQNEDKS----GVLGIDLIINNIVTTSKMVNIGKEGYVAIFDQDKNVVAHPK-----MKPGEKLEEKLSKE 229
Cdd:pfam02743  81 DGKPVLSIARPIYDDSgeviGVLVADLDLETLQELLSQLKLGETGSVFIVDSDGTILAHSDpdligKNLRDSNKSKLSAR 160
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 30018745   230 LYKQEAGDFHYSLDGEDRNITFKTNKKTGWKIAGI 264
Cdd:pfam02743 161 LAKTESGVFSVTLDGEDYLVAYAPIPGTGWTVVVV 195
Tar_Tsr_LBD super family cl00144
ligand binding domain of Tar- and Tsr-related chemoreceptors; E.coli Tar (taxis to aspartate ...
34-148 1.10e-05

ligand binding domain of Tar- and Tsr-related chemoreceptors; E.coli Tar (taxis to aspartate and repellents) and Tsr (taxis to serine and repellents) are homologous chemoreceptors that have a high specificity for aspartate and serine, respectively. Both are homodimeric receptors and contain an N-terminal periplasmic ligand binding domain, a transmembrane region, a HAMP domain and a C-terminal cytosolic signaling domain.


The actual alignment was detected with superfamily member smart00319:

Pssm-ID: 320779  Cd Length: 135  Bit Score: 45.53  E-value: 1.10e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745     34 SYQQAKTNFNETILNSAKDNIKILDNVI--NKELDSKKVDATYFTKLFTQS-----SYQ-----ADQIQNIQNKLEE--- 98
Cdd:smart00319   4 SYQQAALSLSRVLLLQARNNLNRAGIRMmqNNIGSKAKKLMTAASESLKQAeknykSYEnmtalPRADRALDAELKEkfq 83
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|.
gi 30018745     99 -YNKLHPEMEAIYTGSSNGQFIQSPAIQMPDGYNPTERDWYKEAVKKSGEV 148
Cdd:smart00319  84 qYITALQELIQILGNGNLGAFFDQPTQGMQDGFDPAYRDWLQQAVALKGQA 134
 
Name Accession Description Interval E-value
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
287-658 4.65e-69

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 233.73  E-value: 4.65e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 287 ISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNINTSASHVAASS 366
Cdd:COG0840  68 VAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGAS 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 367 EELTASMKQTSEATEQITQAIEQVSSGaeiqtkeveegatlLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQT 446
Cdd:COG0840 148 EEIAASATELSARADQQAESLEEVASA--------------IEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQA 213
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 447 VNQMQLIHESVsqsDKIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQS 526
Cdd:COG0840 214 VEQMQEIAEEL---AEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADS 290
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 527 STEIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQSFAEILKSTNDTVVQIDsmvdvakqmtvdakQVSASINE 606
Cdd:COG0840 291 AKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLIS--------------EIAAATEE 356
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 30018745 607 IAATIEENAASVQNIAGSSEEQLASVDEINAAAVHLSQMAEELQEMISKFKV 658
Cdd:COG0840 357 QTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
382-657 1.39e-64

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 216.77  E-value: 1.39e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    382 QITQAIEQVSSGAEIQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQTVNQMQLIHESVSQSD 461
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    462 KIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQSSTEIGKLVKEIQFDI 541
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    542 KETVSSMNQVGAEVQSGLVVANETKQSFAEILKSTNDTVVQIDSMVDVAKQMTVDAKQVSASINEIAATIEENAASVQNI 621
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 30018745    622 AGSSEEqlasvdeinaaavhLSQMAEELQEMISKFK 657
Cdd:smart00283 241 SAAAEE--------------LSGLAEELDELVERFK 262
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
409-608 6.53e-64

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 212.48  E-value: 6.53e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 409 EEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQTVNQMQLIHESVSQSDKIIGLLDDKSKQIGAILEVIQHIAEQT 488
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 489 NLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQSSTEIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQS 568
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 30018745 569 FAEILKSTNDTVVQIDSMVDVAKQMTVDAKQVSASINEIA 608
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
449-656 1.04e-48

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 171.09  E-value: 1.04e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   449 QMQLIHESVSQSDKIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQSST 528
Cdd:pfam00015  14 EMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAK 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   529 EIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQSFAEILKSTNdtvvQIDSMVDvakqmtvdakQVSASINEIA 608
Cdd:pfam00015  94 EIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVA----EIADIVQ----------EIAAASDEQS 159
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 30018745   609 ATIEENAASVQNIAGSSEEQLASVDEINAAAVHLSQMAEELQEMISKF 656
Cdd:pfam00015 160 AGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
284-658 3.14e-43

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 164.02  E-value: 3.14e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  284 VLGISLIIGGIVIYF-IIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNINTSASHV 362
Cdd:PRK15048 196 VIALVVVLILLVAWYgIRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAI 275
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  363 AASSEELTASMKQTSEATEQitqaieqvssgaeiQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKL 442
Cdd:PRK15048 276 YAGTREIAAGNTDLSSRTEQ--------------QASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKV 341
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  443 VEQTVNQMQLIHESvsqsdkiigllddkSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQ 522
Cdd:PRK15048 342 VDGVVKTMHEIADS--------------SKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASR 407
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  523 SGQSSTEIGKLvkeiqfdIKETVSSMNQVGAEVQSglvvANETKQSFAEILKSTNDTVVQIDSMVDvakQMTVDAKQVSA 602
Cdd:PRK15048 408 SAQAAKEIKAL-------IEDSVSRVDTGSVLVES----AGETMNNIVNAVTRVTDIMGEIASASD---EQSRGIDQVAL 473
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 30018745  603 SINEIAATIEENAASVQNIAgsseeqlasvdeinAAAVHLSQMAEELQEMISKFKV 658
Cdd:PRK15048 474 AVSEMDRVTQQNASLVQESA--------------AAAAALEEQASRLTQAVSAFRL 515
dCache_1 pfam02743
Cache domain; Double cache domain 1 covers the last three strands from the membrane distal ...
159-264 4.01e-08

Cache domain; Double cache domain 1 covers the last three strands from the membrane distal PAS-like domain, the first two strands of the membrane proximal domain, and the connecting elements between the two domains.


Pssm-ID: 308398  Cd Length: 195  Bit Score: 53.74  E-value: 4.01e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   159 TGNIVITLAKQNEDKS----GVLGIDLIINNIVTTSKMVNIGKEGYVAIFDQDKNVVAHPK-----MKPGEKLEEKLSKE 229
Cdd:pfam02743  81 DGKPVLSIARPIYDDSgeviGVLVADLDLETLQELLSQLKLGETGSVFIVDSDGTILAHSDpdligKNLRDSNKSKLSAR 160
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 30018745   230 LYKQEAGDFHYSLDGEDRNITFKTNKKTGWKIAGI 264
Cdd:pfam02743 161 LAKTESGVFSVTLDGEDYLVAYAPIPGTGWTVVVV 195
TarH smart00319
Homologues of the ligand binding domain of Tar; Homologues of the ligand binding domain of the ...
34-148 1.10e-05

Homologues of the ligand binding domain of Tar; Homologues of the ligand binding domain of the wild-type bacterial aspartate receptor, Tar.


Pssm-ID: 128614  Cd Length: 135  Bit Score: 45.53  E-value: 1.10e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745     34 SYQQAKTNFNETILNSAKDNIKILDNVI--NKELDSKKVDATYFTKLFTQS-----SYQ-----ADQIQNIQNKLEE--- 98
Cdd:smart00319   4 SYQQAALSLSRVLLLQARNNLNRAGIRMmqNNIGSKAKKLMTAASESLKQAeknykSYEnmtalPRADRALDAELKEkfq 83
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|.
gi 30018745     99 -YNKLHPEMEAIYTGSSNGQFIQSPAIQMPDGYNPTERDWYKEAVKKSGEV 148
Cdd:smart00319  84 qYITALQELIQILGNGNLGAFFDQPTQGMQDGFDPAYRDWLQQAVALKGQA 134
marine_sort_HK TIGR03785
proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is ...
273-426 1.22e-04

proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase.


Pssm-ID: 163497  Cd Length: 703  Bit Score: 45.12  E-value: 1.22e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   273 AAEPIFYKTVTVLGIsliigGIVIYFIIASI----IKPLKQLVISSKKiSEGDLTESITV-HSKDEIGQLGESFNEMAAS 347
Cdd:TIGR03785 404 ALEKLFNVILAIMSI-----GTLALFGFASWiswrIRRLSDDAEAAID-SQGRISGAIPAsRSRDEIGDLSRSFAQMVAR 477
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   348 LQS---VISNINTSASH-------VAASSEELTASMKQTSEATEQITQAIEQVSSGAEIQTKEVEegATLLEEVTEGIQR 417
Cdd:TIGR03785 478 LRQythYLENMSSRLSHelrtpvaVVRSSLENLELQALEQEKQKYLERAREGTERLSMILNNMSE--ATRLEQAIQSAEV 555
                         170
                  ....*....|
gi 30018745   418 VA-DSSSLVS 426
Cdd:TIGR03785 556 EDfDLSEVLS 565
 
Name Accession Description Interval E-value
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
287-658 4.65e-69

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 233.73  E-value: 4.65e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 287 ISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNINTSASHVAASS 366
Cdd:COG0840  68 VAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGAS 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 367 EELTASMKQTSEATEQITQAIEQVSSGaeiqtkeveegatlLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQT 446
Cdd:COG0840 148 EEIAASATELSARADQQAESLEEVASA--------------IEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQA 213
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 447 VNQMQLIHESVsqsDKIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQS 526
Cdd:COG0840 214 VEQMQEIAEEL---AEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADS 290
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 527 STEIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQSFAEILKSTNDTVVQIDsmvdvakqmtvdakQVSASINE 606
Cdd:COG0840 291 AKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLIS--------------EIAAATEE 356
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 30018745 607 IAATIEENAASVQNIAGSSEEQLASVDEINAAAVHLSQMAEELQEMISKFKV 658
Cdd:COG0840 357 QTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
382-657 1.39e-64

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 216.77  E-value: 1.39e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    382 QITQAIEQVSSGAEIQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQTVNQMQLIHESVSQSD 461
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    462 KIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQSSTEIGKLVKEIQFDI 541
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    542 KETVSSMNQVGAEVQSGLVVANETKQSFAEILKSTNDTVVQIDSMVDVAKQMTVDAKQVSASINEIAATIEENAASVQNI 621
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 30018745    622 AGSSEEqlasvdeinaaavhLSQMAEELQEMISKFK 657
Cdd:smart00283 241 SAAAEE--------------LSGLAEELDELVERFK 262
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
409-608 6.53e-64

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 212.48  E-value: 6.53e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 409 EEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQTVNQMQLIHESVSQSDKIIGLLDDKSKQIGAILEVIQHIAEQT 488
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 489 NLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQSSTEIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQS 568
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 30018745 569 FAEILKSTNDTVVQIDSMVDVAKQMTVDAKQVSASINEIA 608
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
449-656 1.04e-48

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 171.09  E-value: 1.04e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   449 QMQLIHESVSQSDKIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQSST 528
Cdd:pfam00015  14 EMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAK 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   529 EIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQSFAEILKSTNdtvvQIDSMVDvakqmtvdakQVSASINEIA 608
Cdd:pfam00015  94 EIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVA----EIADIVQ----------EIAAASDEQS 159
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 30018745   609 ATIEENAASVQNIAGSSEEQLASVDEINAAAVHLSQMAEELQEMISKF 656
Cdd:pfam00015 160 AGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
284-658 3.14e-43

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 164.02  E-value: 3.14e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  284 VLGISLIIGGIVIYF-IIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNINTSASHV 362
Cdd:PRK15048 196 VIALVVVLILLVAWYgIRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAI 275
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  363 AASSEELTASMKQTSEATEQitqaieqvssgaeiQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKL 442
Cdd:PRK15048 276 YAGTREIAAGNTDLSSRTEQ--------------QASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKV 341
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  443 VEQTVNQMQLIHESvsqsdkiigllddkSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQ 522
Cdd:PRK15048 342 VDGVVKTMHEIADS--------------SKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASR 407
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  523 SGQSSTEIGKLvkeiqfdIKETVSSMNQVGAEVQSglvvANETKQSFAEILKSTNDTVVQIDSMVDvakQMTVDAKQVSA 602
Cdd:PRK15048 408 SAQAAKEIKAL-------IEDSVSRVDTGSVLVES----AGETMNNIVNAVTRVTDIMGEIASASD---EQSRGIDQVAL 473
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 30018745  603 SINEIAATIEENAASVQNIAgsseeqlasvdeinAAAVHLSQMAEELQEMISKFKV 658
Cdd:PRK15048 474 AVSEMDRVTQQNASLVQESA--------------AAAAALEEQASRLTQAVSAFRL 515
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
282-658 5.73e-39

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 151.26  E-value: 5.73e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  282 VTVLGISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNINTSASH 361
Cdd:PRK15041 197 VGVMIVVLAVIFAVWFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANA 276
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  362 VAASSEELTASMKQTSEATEQitqaieqvssgaeiQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGK 441
Cdd:PRK15041 277 IYSGASEIATGNNDLSSRTEQ--------------QAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGK 342
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  442 LVEQTVNQMQLIHESvsqsdkiigllddkSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAE 521
Cdd:PRK15041 343 VVDNVVQTMRDISTS--------------SQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQ 408
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  522 QSGQSSTEIGKLVKEiqfdiketvsSMNQVgaEVQSGLV-VANETKQSFAEILKSTNDTVVQIDSMVDvakQMTVDAKQV 600
Cdd:PRK15041 409 RSAQAAREIKSLIED----------SVGKV--DVGSTLVeSAGETMAEIVSAVTRVTDIMGEIASASD---EQSRGIDQV 473
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 30018745  601 SASINEIAATIEENAASVQNIAgsseeqlasvdeinAAAVHLSQMAEELQEMISKFKV 658
Cdd:PRK15041 474 GLAVAEMDRVTQQNAALVEESA--------------AAAAALEEQASRLTEAVAVFRI 517
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
282-643 3.65e-33

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 134.04  E-value: 3.65e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  282 VTVLGISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNINTSASH 361
Cdd:PRK09793 193 ISMIIVAAIYISSALWWTRKMIVQPLAIIGSHFDSIAAGNLARPIAVYGRNEITAIFASLKTMQQALRGTVSDVRKGSQE 272
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  362 VAASSEELTASMKQTSEATEQitqaieqvssgaeiQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGK 441
Cdd:PRK09793 273 MHIGIAEIVAGNNDLSSRTEQ--------------QAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGV 338
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  442 LVEQTVNQMQLIHESvsqsdkiigllddkSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAE 521
Cdd:PRK09793 339 QVSTMTHTMQEIATS--------------SQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAS 404
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  522 QSGQSSteigklvKEIQFDIKETVSsmnqvgaEVQSGLVVANETKQSFAEILKS---TNDTVVQIDSMVDVAKQmtvDAK 598
Cdd:PRK09793 405 RSAQAA-------KEIKGLIEESVN-------RVQQGSKLVNNAAATMTDIVSSvtrVNDIMGEIASASEEQRR---GIE 467
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*
gi 30018745  599 QVSASINEIAATIEENAASVqniagssEEQLASVDEINAAAVHLS 643
Cdd:PRK09793 468 QVAQAVSQMDQVTQQNASLV-------EEAAVATEQLANQADHLS 505
HAMP pfam00672
HAMP domain;
282-349 3.56e-16

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 75.30  E-value: 3.56e-16
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 30018745   282 VTVLGISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITvHSKDEIGQLGESFNEMAASLQ 349
Cdd:pfam00672   2 LLVLLIALLLALLLAWLLARRILRPLRRLAEAARRIASGDLDVPLE-SGRDEIGELARAFNQMAERLR 68
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
302-353 1.65e-12

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 64.58  E-value: 1.65e-12
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 30018745    302 SIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVIS 353
Cdd:smart00304   2 RLLRPLRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
303-349 4.45e-12

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 63.04  E-value: 4.45e-12
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 30018745 303 IIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQ 349
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLR 47
NarQ COG3850
Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] ...
295-491 5.75e-09

Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms];


Pssm-ID: 226368  Cd Length: 574  Bit Score: 58.90  E-value: 5.75e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 295 VIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISNI--------------NTSAS 360
Cdd:COG3850 167 TIYWLRRRVVRPLNQLTSAAQRIGRRQFDQRPTDTGRNELGLLGRAFNQMSGELKKLYADLeqrveektrdleqkNQRLS 246
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 361 HVAASSEELTASmKQTSEATEQITQAIeQVSSGAEIQTKEVEEG--------ATLLEEVTEGIQRVADSSSLVSTASMYT 432
Cdd:COG3850 247 FLYQSSRRLHTS-QIDDERLRHVLNRL-QNLTGLAAVRLELYGGddernhqeHAEQWDISEGDQPSGLKWPQEDPLTQQG 324
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 30018745 433 KKKAE--NGGKLVEqtvNQMQLIhESVSQsdkiigllddkskQIGAILEVIQHIAEQTNLL 491
Cdd:COG3850 325 HLLGTlpWQRSLPE---DDQQLL-DTLVQ-------------QLGRTLALNKQQEQQQQLL 368
PRK10549 PRK10549
signal transduction histidine-protein kinase BaeS; Provisional
243-349 3.65e-08

signal transduction histidine-protein kinase BaeS; Provisional


Pssm-ID: 182539  Cd Length: 466  Bit Score: 56.18  E-value: 3.65e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745  243 DGEDRNITFKtNKKTGWKIAGimPSKEIIEAAEPIFYK-----TVTVLGISLIIGGIVIYFIIASIIKPLKQLVISSKKI 317
Cdd:PRK10549 126 DGTRRPILVN-GAEVGWVIAS--PVERLTRNTDINFDKqqrrtSWLIVALSTLLAALATFLLARGLLAPVKRLVEGTHKL 202
                         90       100       110
                 ....*....|....*....|....*....|..
gi 30018745  318 SEGDLTESITVHSKDEIGQLGESFNEMAASLQ 349
Cdd:PRK10549 203 AAGDFTTRVTPTSRDELGRLAQDFNQLASTLE 234
dCache_1 pfam02743
Cache domain; Double cache domain 1 covers the last three strands from the membrane distal ...
159-264 4.01e-08

Cache domain; Double cache domain 1 covers the last three strands from the membrane distal PAS-like domain, the first two strands of the membrane proximal domain, and the connecting elements between the two domains.


Pssm-ID: 308398  Cd Length: 195  Bit Score: 53.74  E-value: 4.01e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   159 TGNIVITLAKQNEDKS----GVLGIDLIINNIVTTSKMVNIGKEGYVAIFDQDKNVVAHPK-----MKPGEKLEEKLSKE 229
Cdd:pfam02743  81 DGKPVLSIARPIYDDSgeviGVLVADLDLETLQELLSQLKLGETGSVFIVDSDGTILAHSDpdligKNLRDSNKSKLSAR 160
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 30018745   230 LYKQEAGDFHYSLDGEDRNITFKTNKKTGWKIAGI 264
Cdd:pfam02743 161 LAKTESGVFSVTLDGEDYLVAYAPIPGTGWTVVVV 195
NtrY COG5000
Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation ...
282-393 1.90e-07

Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms];


Pssm-ID: 227333  Cd Length: 712  Bit Score: 54.00  E-value: 1.90e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 282 VTVLGISLIIGGIVIYFIIA---SIIKPLKQLVISSKKISEGDLTESITVHSKDE-IGQLGESFNEMAASLQSvisnint 357
Cdd:COG5000 281 LLYLSTALLVLLAAIWTAIAfarRIVRPIRKLIEAADEVADGDLDVQVPVRRVDEdVGRLSKAFNKMTEQLSS------- 353
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 30018745 358 sashvaasseeLTASMKQTSEATEQITQAIEQVSSG 393
Cdd:COG5000 354 -----------QQEALERAKDALEQRRRFLEAVLSG 378
HAMP COG2770
HAMP domain [Signal transduction mechanisms];
289-353 1.18e-06

HAMP domain [Signal transduction mechanisms];


Pssm-ID: 225359  Cd Length: 83  Bit Score: 48.14  E-value: 1.18e-06
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 30018745 289 LIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVIS 353
Cdd:COG2770  16 VLILAVLLLAAARRVTRPLRRLADLAQNLALGDLSAEIPQPMLDEIGELAKAFNRMRDSLQRALS 80
TarH smart00319
Homologues of the ligand binding domain of Tar; Homologues of the ligand binding domain of the ...
34-148 1.10e-05

Homologues of the ligand binding domain of Tar; Homologues of the ligand binding domain of the wild-type bacterial aspartate receptor, Tar.


Pssm-ID: 128614  Cd Length: 135  Bit Score: 45.53  E-value: 1.10e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745     34 SYQQAKTNFNETILNSAKDNIKILDNVI--NKELDSKKVDATYFTKLFTQS-----SYQ-----ADQIQNIQNKLEE--- 98
Cdd:smart00319   4 SYQQAALSLSRVLLLQARNNLNRAGIRMmqNNIGSKAKKLMTAASESLKQAeknykSYEnmtalPRADRALDAELKEkfq 83
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|.
gi 30018745     99 -YNKLHPEMEAIYTGSSNGQFIQSPAIQMPDGYNPTERDWYKEAVKKSGEV 148
Cdd:smart00319  84 qYITALQELIQILGNGNLGAFFDQPTQGMQDGFDPAYRDWLQQAVALKGQA 134
PRK10935 PRK10935
nitrate/nitrite sensor protein NarQ; Provisional
285-354 1.19e-05

nitrate/nitrite sensor protein NarQ; Provisional


Pssm-ID: 236800  Cd Length: 565  Bit Score: 48.31  E-value: 1.19e-05
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 30018745  285 LGISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTE-SITVHSKDEIGQLGESFNEMAASLQSVISN 354
Cdd:PRK10935 158 LILILTLVFFTVRFTRRQVVAPLNQLVTASQQIEKGQFDHiPLDTTLPNELGLLAKAFNQMSSELHKLYRS 228
Cache_3-Cache_2 pfam17201
Cache 3/Cache 2 fusion domain; The Cache_3-Cache_2 domain likely originated as a fusion of ...
172-277 4.72e-05

Cache 3/Cache 2 fusion domain; The Cache_3-Cache_2 domain likely originated as a fusion of sCache_3 and sCache_2 domains.


Pssm-ID: 319219  Cd Length: 291  Bit Score: 45.39  E-value: 4.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   172 DKSG-VLGI-------DLIINNIVTTSKMVNIGKEGYVAIFDQDK----NVVAHPKMKpGEKLEEKLS------KELYKQ 233
Cdd:pfam17201 162 DADGkVIGIlyvgidqSEILASLRKAIGKAKIGKTGYLYVLDGKGdekgKFIIHPTLK-GKNLLDDADgqrdfvKKMLAK 240
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 30018745   234 EAGDFHYSL----DGEDRNITFKTNKKTGWKIAGIMPSKEIIEAAEPI 277
Cdd:pfam17201 241 KDGSLEYTWkddaKGREKIAVFTYFEPWDWVIVASVYEDEFLAETNRV 288
YhgE COG1511
Uncharacterized membrane protein YhgE, phage infection protein (PIP) family [Function unknown]; ...
300-654 8.31e-05

Uncharacterized membrane protein YhgE, phage infection protein (PIP) family [Function unknown];


Pssm-ID: 224428  Cd Length: 780  Bit Score: 45.57  E-value: 8.31e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 300 IASIIKPLKQLVISSKKISEGDLTesitvhSKDEIGQLGESFNEMAASLQSVISNINTSASHVAASSEELTasmkQTSEA 379
Cdd:COG1511 187 AEKLKDGTDEASNGNKKLSDLLNT------LNNSSATFSDGLNALTSGLTTLTDGLNQLDSGLGTLAAGIG----ELKQG 256
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 380 TEQITQAIEQVSSGAEIQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQTVnqmQLIHESVSQ 459
Cdd:COG1511 257 AEQLNEGIGEFSSGLSELNSGVQDLAAGVPQLNQGISALAAGLSLPDSLGDQFSSLQEALTQIAQGLK---QKTSSSLEA 333
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 460 SDKIIGLLDDKSKqigaileviqhIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVRKLAEQSGQSSTEIGKLVKEIQF 539
Cdd:COG1511 334 AQGSLSSLQSMLA-----------LSKSLDLTAEGATVDALGAPDGVQWLDESQKTLATLSELLSTGIDGVSEGLDALEQ 402
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 540 DIKETVSSMNQVGAEVqsGLVVANETKQSfaEILKSTNDTvVQIDSMVDVAKQMtvdAKQVSASINEIAATIEENAASVQ 619
Cdd:COG1511 403 ASAQLAKSLAKLKTAV--AQIAASIAQLL--PGASEVLKT-LKSKGLDKLLNQL---NGALAKGSNALVQGLSDANDSFR 474
                       330       340       350
                ....*....|....*....|....*....|....*
gi 30018745 620 NIAgsSEEQLASVDEINAAAVHLSQMAEELQEMIS 654
Cdd:COG1511 475 SIT--SAQLKAGLNTLADGSNDLSSLGPGLGQLAD 507
marine_sort_HK TIGR03785
proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is ...
273-426 1.22e-04

proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase.


Pssm-ID: 163497  Cd Length: 703  Bit Score: 45.12  E-value: 1.22e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   273 AAEPIFYKTVTVLGIsliigGIVIYFIIASI----IKPLKQLVISSKKiSEGDLTESITV-HSKDEIGQLGESFNEMAAS 347
Cdd:TIGR03785 404 ALEKLFNVILAIMSI-----GTLALFGFASWiswrIRRLSDDAEAAID-SQGRISGAIPAsRSRDEIGDLSRSFAQMVAR 477
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745   348 LQS---VISNINTSASH-------VAASSEELTASMKQTSEATEQITQAIEQVSSGAEIQTKEVEegATLLEEVTEGIQR 417
Cdd:TIGR03785 478 LRQythYLENMSSRLSHelrtpvaVVRSSLENLELQALEQEKQKYLERAREGTERLSMILNNMSE--ATRLEQAIQSAEV 555
                         170
                  ....*....|
gi 30018745   418 VA-DSSSLVS 426
Cdd:TIGR03785 556 EDfDLSEVLS 565
PRK10600 PRK10600
nitrate/nitrite sensor protein NarX; Provisional
284-348 3.01e-04

nitrate/nitrite sensor protein NarX; Provisional


Pssm-ID: 182581  Cd Length: 569  Bit Score: 43.51  E-value: 3.01e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 30018745  284 VLGISLIIGGIviYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASL 348
Cdd:PRK10600 132 VFMALLLVFTI--IWLRRRLLQPWRQLLSMANAVSHRDFTQRANISGRDEMAMLGTALNNMSAEL 194
VicK COG5002
Signal transduction histidine kinase [Signal transduction mechanisms];
286-354 5.62e-04

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 227335  Cd Length: 459  Bit Score: 42.80  E-value: 5.62e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 30018745 286 GISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGESFNEMAASLQSVISN 354
Cdd:COG5002  37 LIALIITALLGILLARTITKPITDMRKQAVDMARGNYSRKVKVYGTDEIGELADSFNDLTKRVQEAQAN 105
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
362-653 8.89e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 42.35  E-value: 8.89e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    362 VAASSEELTASMKQTSEATEQITQAIEQVSSGAEIQTKEVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGK 441
Cdd:TIGR02168  661 ITGGSAKTNSSILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEA 740
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    442 LVEQTVNQMQLIHESVSQSDKII-GLLDDKSKQIGAILEVIQHIAE--------QTNLLALNAAIEAARA--GEQGRGFA 510
Cdd:TIGR02168  741 EVEQLEERIAQLSKELTELEAEIeELEERLEEAEEELAEAEAEIEEleaqieqlKEELKALREALDELRAelTLLNEEAA 820
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    511 IVADEVRKLAEQSGQSSTEIGKLVKEIQfDIKETVSSMNQV-------GAEVQSGLVVANETKQSFAEILKSTND----T 579
Cdd:TIGR02168  821 NLRERLESLERRIAATERRLEDLEEQIE-ELSEDIESLAAEieeleelIEELESELEALLNERASLEEALALLRSeleeL 899
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 30018745    580 VVQIDSMVDVAKQMTVDAKQVSASINEIAATIEENAASVQNIAgsseEQLASVDEINAaavhlsQMAEELQEMI 653
Cdd:TIGR02168  900 SEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNLQ----ERLSEEYSLTL------EEAEALENKI 963
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
331-445 1.60e-03

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 40.73  E-value: 1.60e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    331 KDEIGQLGESFNEMAASLQSVISNINTSASHVaassEELTASMKQTSEATEQITQAIEQVSSGAEIQTKEVEEGATLLEE 410
Cdd:smart00283 150 ESLIKEIQEETNEAVAAMEESSSEVEEGVELV----EETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDE 225
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 30018745    411 VTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQ 445
Cdd:smart00283 226 IAQVTQETAAMSEEISAAAEELSGLAEELDELVER 260
COG5613 COG5613
Uncharacterized protein [Function unknown];
344-653 1.97e-03

Uncharacterized protein [Function unknown];


Pssm-ID: 227900  Cd Length: 400  Bit Score: 40.72  E-value: 1.97e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 344 MAASLQSVISNINTSASHVAASSEELTASMKQTSEATEQITQAIEqvssgaeiQTKEVEEgATLLEEVTEGIQRVADSSS 423
Cdd:COG5613  67 TTSAAEDVLSKLFQSVSGEVTSATEVAEAQRSSYPYLSQVNLASP--------QQFEIEL-AKLLSLVESAQKVSKLLNS 137
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 424 LVSTASMYTKKKAENGGKLVEQTVNQMQLihESVSQSDKIIGLLDD-KSKQIGAILEVIQHIAEQTNLLALNAAIEAARA 502
Cdd:COG5613 138 NEIYMDQNTKKMENNQQKIKKQEEEAKKA--EKSGQASKIFGWVSAfGSLIVALIMVAAGVGAAAGAVMAASGATAMALQ 215
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 503 GEQ--GRGFAIVADEVRKLAEQSGQSSTEIGKLVKEIQFDIKeTVSSMNQVGAEVQSglvVANETKQSF----------- 569
Cdd:COG5613 216 SVEqvAVMGLISPEGMKTLAPVFGEIEEAISMAASVLTFGGA-AVGGLASLGAKFGN---VANNMTRSIgssvakegamv 291
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745 570 ----AEILKSTNDTVVQI-DSMVDV---AKQMTVDAKQVSASINEiaATIEENAASVQNIAGSSEeqlasvdEINAAAVH 641
Cdd:COG5613 292 gekaGEALSKCFNVFAKIsTVALGVtngIRQAGTTALNAEAAQLQ--ADSQLAAADVQNLQRIIE-------RLKEELKL 362
                       330
                ....*....|..
gi 30018745 642 LSQMAEELQEMI 653
Cdd:COG5613 363 ELEKAQEEMENI 374
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
300-412 2.13e-03

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 40.35  E-value: 2.13e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018745    300 IASIIKPLKQLVISSkkISEGDLTESITVHSKDEIGQLGESFNEMAASLQSV---ISNINTSASHVAASSEELTASMKQT 376
Cdd:smart00283 149 IESLIKEIQEETNEA--VAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIadlVQEIAAATDEQAAGSEEVNAAIDEI 226
                           90       100       110
                   ....*....|....*....|....*....|....*.
gi 30018745    377 SEATEQITQAIEQVSSGAEIQTKEVEEGATLLEEVT 412
Cdd:smart00283 227 AQVTQETAAMSEEISAAAEELSGLAEELDELVERFK 262
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH