NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|297747294|ref|NP_001172113|]
View 

regulator of G-protein signaling 4 [Sus scrofa]

Protein Classification

RGS_RGS4 domain-containing protein (domain architecture ID 10171633)

RGS_RGS4 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RGS_RGS4 cd08714
Regulator of G protein signaling (RGS) domain found in the RGS4 protein; The RGS (Regulator of ...
63-176 8.50e-69

Regulator of G protein signaling (RGS) domain found in the RGS4 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS4 protein. RGS4 is a member of the R4/RGS subfamily of the RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. RGS4 is expressed widely in brain including prefrontal cortex, striatum, locus coeruleus (LC), and hippocampus and has been implicated in regulation of opioid, cholinergic, and serotonergic signaling. Dysfunctions in RGS4 proteins are involved in etiology of Parkinson's disease, addiction, and schizophrenia. RGS4 also is up-regulated in the failing human heart. RGS4 interacts with many binding partners outside of GPCR pathways, including calmodulin, COP, Kir3, PIP, calcium/CaM, PA, ErbB3, and 14-3-3.


:

Pssm-ID: 188669  Cd Length: 114  Bit Score: 209.35  E-value: 8.50e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08714    1 LENLINHECGLAAFKAFLKSEYSEENIDFWVSCEDYKKTKSPSKLSPKARKIYEEFISVQATKEVNLDSCTREETSRNML 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08714   81 EPTISCFDEAQKKIFTLMEKDSYRRFLKSRFYLD 114
 
Name Accession Description Interval E-value
RGS_RGS4 cd08714
Regulator of G protein signaling (RGS) domain found in the RGS4 protein; The RGS (Regulator of ...
63-176 8.50e-69

Regulator of G protein signaling (RGS) domain found in the RGS4 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS4 protein. RGS4 is a member of the R4/RGS subfamily of the RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. RGS4 is expressed widely in brain including prefrontal cortex, striatum, locus coeruleus (LC), and hippocampus and has been implicated in regulation of opioid, cholinergic, and serotonergic signaling. Dysfunctions in RGS4 proteins are involved in etiology of Parkinson's disease, addiction, and schizophrenia. RGS4 also is up-regulated in the failing human heart. RGS4 interacts with many binding partners outside of GPCR pathways, including calmodulin, COP, Kir3, PIP, calcium/CaM, PA, ErbB3, and 14-3-3.


Pssm-ID: 188669  Cd Length: 114  Bit Score: 209.35  E-value: 8.50e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08714    1 LENLINHECGLAAFKAFLKSEYSEENIDFWVSCEDYKKTKSPSKLSPKARKIYEEFISVQATKEVNLDSCTREETSRNML 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08714   81 EPTISCFDEAQKKIFTLMEKDSYRRFLKSRFYLD 114
RGS pfam00615
Regulator of G protein signaling domain; RGS family members are GTPase-activating proteins for ...
62-177 2.68e-45

Regulator of G protein signaling domain; RGS family members are GTPase-activating proteins for heterotrimeric G-protein alpha-subunits.


Pssm-ID: 306968  Cd Length: 117  Bit Score: 149.30  E-value: 2.68e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294   62 SLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNM 141
Cdd:pfam00615   1 SLDSLLEDQPGRRLFREFLESEFSEENLEFWLACEEFKKADPDEERLQKAKEIYNKFLAPDSPKEINLDSDTREEIKANL 80
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 297747294  142 L-EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177
Cdd:pfam00615  81 KnEPTRDLFDEAQREVYDLLEKDSYPRFLKSPLYLRL 117
RGS smart00315
Regulator of G protein signalling domain; RGS family members are GTPase-activating proteins ...
62-177 1.82e-40

Regulator of G protein signalling domain; RGS family members are GTPase-activating proteins for heterotrimeric G-protein alpha-subunits.


Pssm-ID: 214613  Cd Length: 118  Bit Score: 136.63  E-value: 1.82e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294    62 SLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNM 141
Cdd:smart00315   1 SLESLLSDPIGRLLFREFLESEFSEENLEFWLAVEEFKKAEDDEERIAKAREIYDKFLSPNAPKEVNLDSDLREKIEENL 80
                           90       100       110
                   ....*....|....*....|....*....|....*...
gi 297747294   142 L--EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177
Cdd:smart00315  81 EseEPPPDLFDEAQREVYELLEKDSFPRFLESDYYLRF 118
 
Name Accession Description Interval E-value
RGS_RGS4 cd08714
Regulator of G protein signaling (RGS) domain found in the RGS4 protein; The RGS (Regulator of ...
63-176 8.50e-69

Regulator of G protein signaling (RGS) domain found in the RGS4 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS4 protein. RGS4 is a member of the R4/RGS subfamily of the RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. RGS4 is expressed widely in brain including prefrontal cortex, striatum, locus coeruleus (LC), and hippocampus and has been implicated in regulation of opioid, cholinergic, and serotonergic signaling. Dysfunctions in RGS4 proteins are involved in etiology of Parkinson's disease, addiction, and schizophrenia. RGS4 also is up-regulated in the failing human heart. RGS4 interacts with many binding partners outside of GPCR pathways, including calmodulin, COP, Kir3, PIP, calcium/CaM, PA, ErbB3, and 14-3-3.


Pssm-ID: 188669  Cd Length: 114  Bit Score: 209.35  E-value: 8.50e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08714    1 LENLINHECGLAAFKAFLKSEYSEENIDFWVSCEDYKKTKSPSKLSPKARKIYEEFISVQATKEVNLDSCTREETSRNML 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08714   81 EPTISCFDEAQKKIFTLMEKDSYRRFLKSRFYLD 114
RGS_RGS3 cd08713
Regulator of G protein signaling (RGS) domain found in the RGS3 protein; The RGS (Regulator of ...
63-176 2.14e-52

Regulator of G protein signaling (RGS) domain found in the RGS3 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS3 protein. RGS3 is a member of the R4/RGS subfamily of the RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes. RGS3 induces apoptosis when overexpressed and is involved in cell migration through interaction with the Ephrin receptor. RGS3 exits as several splice isoforms and interacts with neuroligin, estrogen receptor-alpha, and 14-3-3 outside of the GPCR pathways.


Pssm-ID: 188668  Cd Length: 114  Bit Score: 167.35  E-value: 2.14e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08713    1 LEKLLLHKYGLAVFRAFLQTEFSEENLEFWLACEEYKKIKSQSKMASRAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQ 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08713   81 NPTRGCFDLAQKRIYGLMEKDSYPRFLRSDLYQD 114
RGS_RGS8 cd08711
Regulator of G protein signaling (RGS) domain found in the RGS8 protein; The RGS (Regulator of ...
52-176 3.30e-47

Regulator of G protein signaling (RGS) domain found in the RGS8 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS8 protein. RGS8 is a member of R4/RGS subfamily of RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS8 is involved in G-protein-gated potassium channels regulation and predominantly expressed in the brain. RGS8 also is selectively expressed in the hematopoietic system (NK cells).


Pssm-ID: 188666  Cd Length: 125  Bit Score: 154.51  E-value: 3.30e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  52 SQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDS 131
Cdd:cd08711    1 STEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDF 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 297747294 132 CTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08711   81 QTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLD 125
RGS pfam00615
Regulator of G protein signaling domain; RGS family members are GTPase-activating proteins for ...
62-177 2.68e-45

Regulator of G protein signaling domain; RGS family members are GTPase-activating proteins for heterotrimeric G-protein alpha-subunits.


Pssm-ID: 306968  Cd Length: 117  Bit Score: 149.30  E-value: 2.68e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294   62 SLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNM 141
Cdd:pfam00615   1 SLDSLLEDQPGRRLFREFLESEFSEENLEFWLACEEFKKADPDEERLQKAKEIYNKFLAPDSPKEINLDSDTREEIKANL 80
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 297747294  142 L-EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177
Cdd:pfam00615  81 KnEPTRDLFDEAQREVYDLLEKDSYPRFLKSPLYLRL 117
RGS_RGS5 cd08717
Regulator of G protein signaling (RGS) domain found in the RGS5 protein; The RGS (Regulator of ...
63-174 1.89e-44

Regulator of G protein signaling (RGS) domain found in the RGS5 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS5 protein. RGS5 is member of the R4/RGS subfamily of the RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. Two splice isoforms of RGS5 has been found: RGS5L (long) which is expressed in smooth muscle cells (pericytes) and heart and RGS5S (short) which is highly expressed in the ciliary body of the eye, kidney, brain, spleen, skeletal muscle, and small intestine. Outside of the GPCR pathway, RGS5 interacts with the 14-3-3 protein.


Pssm-ID: 188672  Cd Length: 114  Bit Score: 147.06  E-value: 1.89e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08717    1 LDKLLQNSYGLASFKSFLKSEFSEENIEFWEACEDYKKTKSPLKMATKAKKIYEEFIQTEAPKEVNIDHFTKDVTMKNLV 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08717   81 EPSSSSFDLAQKRIFALMEKDSLPRFVRSEFY 112
RGS_RGS2 cd08709
Regulator of G protein signaling (RGS) domain found in the RGS2 protein; The RGS (Regulator of ...
63-176 1.14e-43

Regulator of G protein signaling (RGS) domain found in the RGS2 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS2 protein. RGS2 is a member of R4/RGS subfamily of RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G- alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS2 plays important roles in the regulation of blood pressure and the pathogenesis of human hypertension, as well as in bone formation in osteoblasts. Outside of the GPCR pathway RGS2 interacts with calmodulin, beta- COP, tubulin, PKG1-alpha, and TRPV6.


Pssm-ID: 188664  Cd Length: 114  Bit Score: 144.81  E-value: 1.14e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08709    1 FDELLASKYGVAAFRAFLKSEFSEENIEFWLACEDFKKTKSPQKLTSKAKKIYTDFIEKEAPKEINIDFQTKTLIAQNIQ 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08709   81 EATSGCFTAAQKRVYSLMENNSYPRFLESEFYQE 114
RGS_RGS18 cd08712
Regulator of G protein signaling (RGS) domain found in the RGS18 protein; The RGS (Regulator ...
63-176 3.29e-43

Regulator of G protein signaling (RGS) domain found in the RGS18 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS18 protein. RGS18 is a member of the RGS protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS18 is a member of the R4/RGS subfamily and is expressed predominantly in osteoclasts where it acts as a negative regulator of the acidosis-induced osteoclastogenic OGR1/NFAT signaling pathway. RANKL (receptor activator of nuclear factor B ligand) stimulates osteoclastogenesis by inhibiting expression of RGS18.


Pssm-ID: 188667  Cd Length: 114  Bit Score: 143.54  E-value: 3.29e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08712    1 FDKLLSHKDGLEAFTRFLKTEFSEENIEFWIACEDYKKSKTPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVTTNSIE 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08712   81 QPTLTSFDAAQSRVYQLMEQDSYPRFLKSDIYLD 114
RGS_RGS1 cd08715
Regulator of G protein signaling (RGS) domain found in the RGS1 protein; The RGS (Regulator of ...
63-177 3.84e-41

Regulator of G protein signaling (RGS) domain found in the RGS1 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS1 protein. RGS1 is a member of the R4/RGS subfamily of the RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS 1 is expressed predominantly in hematopoietic compartments, including T and B lymphocytes, and may play a major role in chemokine-mediated homing of lymphocytes to secondary lymphoid organs. In addition, RGS1 interacts with calmodulin and 14-3-3 protein outside of the GPCR pathway.


Pssm-ID: 188670  Cd Length: 114  Bit Score: 138.54  E-value: 3.84e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSpSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08715    1 LEKLLASQTGQNVFRSFLKSEFSEENIEFWLACEDYKKTES-DLLPCKAEEIYKEFVQSDAAKQINIDFRTRESTAKKIK 79
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177
Cdd:cd08715   80 APTPTCFDEAQKVIYILMERDSYPRFLKSDIYLNL 114
RGS smart00315
Regulator of G protein signalling domain; RGS family members are GTPase-activating proteins ...
62-177 1.82e-40

Regulator of G protein signalling domain; RGS family members are GTPase-activating proteins for heterotrimeric G-protein alpha-subunits.


Pssm-ID: 214613  Cd Length: 118  Bit Score: 136.63  E-value: 1.82e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294    62 SLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNM 141
Cdd:smart00315   1 SLESLLSDPIGRLLFREFLESEFSEENLEFWLAVEEFKKAEDDEERIAKAREIYDKFLSPNAPKEVNLDSDLREKIEENL 80
                           90       100       110
                   ....*....|....*....|....*....|....*...
gi 297747294   142 L--EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177
Cdd:smart00315  81 EseEPPPDLFDEAQREVYELLEKDSFPRFLESDYYLRF 118
RGS_RGS16 cd08710
Regulator of G protein signaling (RGS) domain found in the RGS16 protein; The RGS (Regulator ...
66-176 2.01e-40

Regulator of G protein signaling (RGS) domain found in the RGS16 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS16 protein. RGS16 is a member of the RGS protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS16 is a member of the R4/RGS subfamily and interacts with neuronal G-alpha0. RGS16 expression is upregulated by IL-17 of the NF-kappaB signaling pathway in autoimmune B cells.


Pssm-ID: 188665  Cd Length: 114  Bit Score: 136.74  E-value: 2.01e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  66 LISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNMLEPT 145
Cdd:cd08710    4 LLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFEEFIRSEAPKEVNIDHETRELTRTNLQAAT 83
                         90       100       110
                 ....*....|....*....|....*....|.
gi 297747294 146 ITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08710   84 TSCFDVAQGKTRTLMEKDSYPRFLKSPAYRD 114
RGS_RZ-like cd08718
Regulator of G protein signaling (RGS) domain found in the RZ protein; The RGS (Regulator of ...
59-174 5.00e-40

Regulator of G protein signaling (RGS) domain found in the RZ protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RZ subfamily of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. Deactivation of G-protein signaling is controlled by RGS domains, which accelerate GTPase activity of the alpha subunit by hydrolysis of GTP to GDP, which results in reassociation of the alpha-subunit with the beta-gamma-dimer and inhibition of downstream activity. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. The RZ subfamily of RGS proteins includes RGS17, RGS19 (former GAIP), RGS20, and its splice variant Ret-RGS.


Pssm-ID: 188673  Cd Length: 118  Bit Score: 135.67  E-value: 5.00e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  59 WAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETS 138
Cdd:cd08718    1 WAQSFDKLMKSPAGRNVFREFLRTEYSEENMLFWLACEELKKEANKHVIEEKARLIYEDYISILSPKEVSLDSRVREVIN 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 297747294 139 RNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08718   81 RNMLEPSPHTFDDAQLQIYTLMHRDSYPRFLNSAIY 116
RGS_RGS21 cd08723
Regulator of G protein signaling (RGS) domain found in the RGS21 protein; The RGS (Regulator ...
66-174 1.37e-39

Regulator of G protein signaling (RGS) domain found in the RGS21 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part RGS21 protein, a member of RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes. RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, skeletal and muscle development, cell migration during early embryogenesis, apoptosis, and cell proliferation, as well as modulation of cardiac development. RGS21 is a member of the R4/RGS subfamily and its mRNA was detected only in sensory taste cells that express sweet taste receptors and the taste G-alpha subunit, gustducin, suggesting a potential role in regulating taste transduction.


Pssm-ID: 188678  Cd Length: 111  Bit Score: 134.41  E-value: 1.37e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  66 LISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNMLEPT 145
Cdd:cd08723    1 LLANQAGLDAFRTFLKSEFSEENVEFWLACEDFKKTKSSTEIALKAQMIYSEFIQADAPKEINIDFHTRDLISQNISEPT 80
                         90       100
                 ....*....|....*....|....*....
gi 297747294 146 ITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08723   81 LKCFDEAQSLIYCLMAKDSFPRFLKSEVY 109
RGS cd07440
Regulator of G protein signaling (RGS) domain superfamily; The RGS domain is an essential part ...
67-176 3.37e-36

Regulator of G protein signaling (RGS) domain superfamily; The RGS domain is an essential part of the Regulator of G-protein Signaling (RGS) protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. While inactive, G-alpha-subunits bind GDP, which is released and replaced by GTP upon agonist activation. GTP binding leads to dissociation of the alpha-subunit and the beta-gamma-dimer, allowing them to interact with effectors molecules and propagate signaling cascades associated with cellular growth, survival, migration, and invasion. Deactivation of the G-protein signaling controlled by the RGS domain accelerates GTPase activity of the alpha subunit by hydrolysis of GTP to GDP, which results in the reassociation of the alpha-subunit with the beta-gamma-dimer and thereby inhibition of downstream activity. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins are also involved in apoptosis and cell proliferation, as well as modulation of cardiac development. Several RGS proteins can fine-tune immune responses, while others play important roles in neuronal signals modulation. Some RGS proteins are principal elements needed for proper vision.


Pssm-ID: 188659  Cd Length: 113  Bit Score: 125.58  E-value: 3.37e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  67 ISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIK-SPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNMLEP- 144
Cdd:cd07440    1 LRDPYGLEYFRQFLKSEHCEENLEFWLAVEKFKKTTsSDEELKSKAKEIYDKYISKDAPKEINIPESIREEIEENLEEPy 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 297747294 145 -TITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd07440   81 pDPDCFDEAQEHILNLLEKDSYPRFLKSDLYLK 113
RGS_RGS13 cd08716
Regulator of G protein signaling (RGS) domain found in the RGS13 protein; The RGS (Regulator ...
64-174 3.75e-36

Regulator of G protein signaling (RGS) domain found in the RGS13 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS13 protein. RGS13 is member of the R4/RGS subfamily of the RGS family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha subunits. The RGS domain controls G-protein signaling by accelerating the GTPase activity of the G-alpha subunit which leads to G protein deactivation and promotes desensitization. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS13 is predominantly expressed in T and B lymphocytes and in mast cells, and plays a role in adaptive immune responses. RGS13 also found in Rgs13, which is also expressed in dendritic cells and in neuroendocrine cells of the thymus, gastrointestinal, and respiratory tracts. Outside of the GPCR pathway, RGS5 interacts with the PIP3 protein.


Pssm-ID: 188671  Cd Length: 114  Bit Score: 125.42  E-value: 3.75e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  64 ENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNMLE 143
Cdd:cd08716    2 ENLMATKYGPIIYATYLKTEHSDENIEFWLACETYKKIASQRKRISMARKLFASYIQPQAPREINIDSPTRKAIIRNIQE 81
                         90       100       110
                 ....*....|....*....|....*....|.
gi 297747294 144 PTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08716   82 PTQSCFDEAQRIVYMHMERDSYPRFLESKFY 112
RGS_RGS20 cd08746
Regulator of G protein signaling (RGS) domain found in the RGS20 protein; The RGS (Regulator ...
54-176 4.07e-36

Regulator of G protein signaling (RGS) domain found in the RGS20 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS20 protein (also known as RGSZ1), a member of the RZ subfamily of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. Deactivation of G-protein signaling is controlled by the RGS domain, which accelerates GTPase activity of the alpha subunit by hydrolysis of GTP to GDP resulting in reassociation of the alpha-subunit with the beta-gamma-dimer and inhibition of downstream activity. As a major G-protein regulator, the RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. The RZ subfamily of RGS proteins include RGS17, RGS19 (former GAIP), and the splice variant of RGS20, Ret-RGS. RGS20 is expressed exclusively in brain, with the highest concentrations in the temporal lobe and the caudate nucleus and may play a role in signaling regulation in these brain regions. RGS20 acts as a GAP of both G-alpha-z and G-alpha-I and controls signaling in the mu opioid receptor pathway.


Pssm-ID: 188700  Cd Length: 167  Bit Score: 127.02  E-value: 4.07e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  54 EEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCT 133
Cdd:cd08746   45 EEVCAWGQSFDKLMLTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKSVIEEKARIIYEDYISILSPKEVSLDSRV 124
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297747294 134 REETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08746  125 REVINRNMLEPSQHTFDDAQLQIYTLMHRDSYPRFMNSAIYKN 167
RGS_RGS19 cd08745
Regulator of G protein signaling (RGS) domain found in the RGS19 protein; The RGS (Regulator ...
59-174 8.89e-36

Regulator of G protein signaling (RGS) domain found in the RGS19 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS19 protein (also known as GAIP), a member of the RZ subfamily of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. Deactivation of G-protein signaling is controlled by RGS domains, which accelerate GTPase activity of the alpha subunit by hydrolysis of GTP to GDP, resulting in a reassociation of the alpha-subunit with the beta-gamma-dimer and an inhibition of downstream activity. As a major G-protein regulator, the RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. The RZ subfamily of RGS proteins includes RGS17, RGS20, and its splice variant Ret-RGS. RGS19 participates in regulation of dopamine receptor D2R and D3R, as well as beta-adrenergic receptors .


Pssm-ID: 188699  Cd Length: 118  Bit Score: 124.78  E-value: 8.89e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  59 WAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETS 138
Cdd:cd08745    1 WAQSFDKLMKSPAGRNVFREFLRTEYSEENMLFWLACEELKAEANKHVIDEKARLIYEDYISILSPKEVSLDSRVREGIN 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 297747294 139 RNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08745   81 RKMQEPSSHTFDDAQLQIYTLMHRDSYPRFLNSPIY 116
RGS_R7-like cd08705
Regulator of G protein signaling (RGS) domain found in the R7 subfamily of proteins; The RGS ...
56-174 3.75e-35

Regulator of G protein signaling (RGS) domain found in the R7 subfamily of proteins; The RGS (Regulator of G-protein Signaling) domain is an essential part of the R7 (Neuronal RGS) protein subfamily of the RGS protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. The R7 subfamily includes RGS6, RGS7, RGS9, and RGS11, all of which, in humans, are expressed predominantly in the nervous system, form an obligatory complex with G-beta-5, and play important roles in the regulation of crucial neuronal processes. In addition, R7 proteins were found to bind many other proteins outside of the G protein signaling pathways including: m-opioid receptor, beta-arrestin, alpha-actinin-2, NMDAR, polycystin, spinophilin, guanylyl cyclase, among others.


Pssm-ID: 188660  Cd Length: 121  Bit Score: 123.12  E-value: 3.75e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  56 VKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKiKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTRE 135
Cdd:cd08705    2 VKRWGFSFSELLKDPVGREQFLKFLEKEFSGENLRFWEACQDLKY-GPQSQVPEKVQEIYQEFLAPGAPSWINIDSKTME 80
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 297747294 136 ETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08705   81 ITLKNLKDPHRYTFDAAQEHIYMLMKKDSYPRFLRSDIY 119
RGS_R12-like cd08706
Regulator of G protein signaling (RGS) domain found in the R12 subfamily of proteins; The RGS ...
63-176 2.67e-34

Regulator of G protein signaling (RGS) domain found in the R12 subfamily of proteins; The RGS (Regulator of G-protein Signaling) domain is an essential part of the R12 (Neuronal RGS) protein subfamily of the RGS protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play a critical regulatory role as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. Deactivation of G-protein signaling, controlled by RGS domain, accelerates GTPase activity of the alpha subunit by hydrolysis of GTP to GDP that results in reassociation of the alpha-subunit with the beta-gamma-dimer and thereby inhibition of downstream activity. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. The R12 RGS subfamily includes RGS10, RGS12 and RGS14 all of which are highly selective for G-alpha-i1 over G-alpha-q.


Pssm-ID: 188661  Cd Length: 113  Bit Score: 120.51  E-value: 2.67e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDScTREETSRNML 142
Cdd:cd08706    1 FERLLQDPVGVKYFTEFLKKEFSEENILFWQACEKFKKIPDKKQLVQEAREIYDTFLSSKASSPVNIDS-QAQLAEEMLE 79
                         90       100       110
                 ....*....|....*....|....*....|....
gi 297747294 143 EPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08706   80 EPHPDMFQKQQLQIFNLMKFDSYSRFLKSPLYQQ 113
RGS_RGS14 cd08743
Regulator of G protein signaling (RGS) domain found in the RGS14 protein; RGS (Regulator of ...
53-176 3.11e-28

Regulator of G protein signaling (RGS) domain found in the RGS14 protein; RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS14 protein. RGS14 is a member of the RA/RGS subfamily of RGS proteins family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS14 belong to the R12 RGS subfamily, which includes RGS10 and RGS12, all of which are highly selective for G-alpha-i1 over G-alpha-q. RGS14 binds and regulates the subcellular localization and activities of H-Ras and Raf kinases in cells and thereby integrates G protein and Ras/Raf signaling pathways.


Pssm-ID: 188697  Cd Length: 129  Bit Score: 105.11  E-value: 3.11e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  53 QEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKS--PSKLSPRAKKIYNEFISVQQTKEVNLD 130
Cdd:cd08743    1 EKSVASWAVSFERLLQDPLGVEYFTEFLKKEFSAENVNFWKACERFQQIPAsdTQQLAQEARKIYNEFLSSSSQSPVNID 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 297747294 131 SctREETSRNMLE-PTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08743   81 Q--QAWIGEDMLAtPSPDMFRAQQLQIFNLMKFDSYARFVKSPLYQD 125
RGS_RGS17 cd08744
Regulator of G protein signaling (RGS) domain found in the RGS17 protein; The RGS (Regulator ...
59-174 9.75e-28

Regulator of G protein signaling (RGS) domain found in the RGS17 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS17 protein, a member of the RZ subfamily of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, the RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. Deactivation of the G-protein signaling controlled by the RGS domain, which accelerates GTPase activity of the alpha subunit by hydrolysis of GTP to GDP, results in reassociation of the alpha-subunit with the beta-gamma-dimer and inhibition of downstream activity. The RZ subfamily of RGS proteins includes RGS19 (former GAIP), RGS20, and its splice variant Ret-RGS. RGS17 is a relatively non-selective GAP for G-alpha-z and other G-alpha-i/o proteins. RGS17 blocks dopamine receptor-mediated inhibition of cAMP accumulation; it also blocks thyrotropin releasing hormone-stimulated Ca++ mobilization. RGS17, like other members of RZ subfamily, can act either as a GAP or as G-protein effector antogonist.


Pssm-ID: 188698  Cd Length: 118  Bit Score: 103.65  E-value: 9.75e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  59 WAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETS 138
Cdd:cd08744    1 WSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARLIYEDYISILSPKEVSLDSRVREVIN 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 297747294 139 RNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08744   81 RNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIY 116
RGS_RGS6 cd08737
Regulator of G protein signaling (RGS) domain found in the RGS6 protein; The RGS (Regulator of ...
54-177 1.61e-27

Regulator of G protein signaling (RGS) domain found in the RGS6 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS6 protein, a member of R7 subfamily of the RGS protein family. RGS is a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). Other members of the R7 subfamily (Neuronal RGS) include: RGS7, RGS9, and RGS11, all of which are expressed predominantly in the nervous system, form an obligatory complex with G-beta-5, and play important roles in the regulation of crucial neuronal processes such as vision and motor control. Additionally they have been implicated in many neurological conditions such as anxiety, schizophrenia, and drug dependence. RGS6 exists in multiple splice isoforms with identical RGS domains, but possess complete or incomplete GGL domains and distinct N- and C-terminal domains. RGS6 interacts with SCG10, a neuronal growth-associated protein and therefore regulates neuronal differentiation. Another RGS6-binding protein is DMAP1, a component of the Dnmt1 complex involved in repression of newly replicated genes. Mutations of a critical residue required for interaction of RGS6 protein with G proteins did not affect the ability of RGS6 to interact with both SCG10 and DMAP1. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis.


Pssm-ID: 188691  Cd Length: 125  Bit Score: 103.17  E-value: 1.61e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  54 EEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKiKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCT 133
Cdd:cd08737    1 QRVKRWGFSLDEVLKDPVGRDQFLRFLESEFSSENLRFWLAVQDLKK-QPLQDVAKRVEEIWQEFLAPGAPSAINLDSHS 79
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 297747294 134 REETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177
Cdd:cd08737   80 YEKTSQNVKDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDL 123
RGS_RGS10 cd08741
Regulator of G protein signaling (RGS) domain found in the RGS10 protein; RGS (Regulator of ...
63-176 1.02e-26

Regulator of G protein signaling (RGS) domain found in the RGS10 protein; RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS10 protein. RGS10 is a member of the RA/RGS subfamily of RGS proteins family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS10 belong to the R12 RGS subfamily, which includes RGS12 and RGS14, all of which are highly selective for G-alpha-i1 over G-alpha-q. RGS10 exists in 2 splice isoforms. RGS10A is specifically expressed in osteoclasts and is a key component in the RANKL signaling mechanism for osteoclast differentiation, whereas RGS10B expressed in brain and in immune tissues and has been implicated in diverse processes including: promoting of dopaminergic neuron survival via regulation of the microglial inflammatory response, modulation of presynaptic and postsynaptic G-protein signalling, as well as a possible role in regulation of gene expression.


Pssm-ID: 188695  Cd Length: 113  Bit Score: 100.89  E-value: 1.02e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTReeTSRNML 142
Cdd:cd08741    1 LENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSR--LNEKIL 78
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 297747294 143 E-PTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD 176
Cdd:cd08741   79 EePHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLK 113
RGS_RGS9 cd08739
Regulator of G protein signaling (RGS) domain found in the RGS9 protein; The RGS (Regulator of ...
56-174 8.50e-24

Regulator of G protein signaling (RGS) domain found in the RGS9 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS9 protein, a member of R7 subfamily of the RGS protein family. RGS is a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. Other members of the R7 subfamily (Neuronal RGS) include: RGS6, RGS7, and RGS11, all of which are expressed predominantly in the nervous system, form an obligatory complex with G-beta-5, and play important roles in the regulation of crucial neuronal processes such as vision and motor control. Additionally they have been implicated in many neurological conditions such as anxiety, schizophrenia, and drug dependence. RGS9 forms constitutive complexes with G-beta-5 subunit and controls such fundamental functions as vision and behavior. RGS9 exists in two splice isoforms: RGS9-1 which regulates phototransduction in rods and cones and RGS9-2 which regulates dopamine and opioid signaling in the basal ganglia. In addition, RGS9 was found to bind many other proteins outside of G protein signaling pathways including: mu-opioid receptor, beta-arrestin, alpha-actinin-2, NMDAR, polycystin, spinophilin, and guanylyl cyclase, among others.


Pssm-ID: 188693  Cd Length: 121  Bit Score: 93.17  E-value: 8.50e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  56 VKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKkIKSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTRE 135
Cdd:cd08739    2 VERWAFNFSELIRDPKGRQSFQLFLKKEFSGENLGFWEACEDLK-YGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMD 80
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 297747294 136 ETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08739   81 ITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIY 119
RGS_RGS11 cd08740
Regulator of G protein signaling (RGS) domain found in the RGS11 protein; The RGS (Regulator ...
56-177 3.59e-23

Regulator of G protein signaling (RGS) domain found in the RGS11 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS11 protein, a member of R7 subfamily of the RGS protein family. RGS is a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. Other members of the R7 subfamily (Neuronal RGS) include: RGS6, RGS7, and RGS9, all of which are expressed predominantly in the nervous system, form an obligatory complex with G-beta-5, and play important roles in the regulation of crucial neuronal processes such as vision and motor control. Additionally they have been implicated in many neurological conditions such as anxiety, schizophrenia, and drug dependence. RGS11 is expressed exclusively in retinal ON-bipolar neurons in which it forms complexes with G-beta-5 and R7AP (RGS7 anchor protein ) and plays crucial roles in processing the light responses of retinal neurons.


Pssm-ID: 188694  Cd Length: 126  Bit Score: 91.90  E-value: 3.59e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  56 VKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSpSKLSPRAKKIYNEFISVQQTKEVNLDSCTRE 135
Cdd:cd08740    3 VERWGFSFRELLNDPVGRKEFLDFLEKEFSAENLSFWEACEELRYGEQ-SKIPELVDSVYQQFLAPGATRWVNIDSKTME 81
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 297747294 136 ETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177
Cdd:cd08740   82 RTLEGLKQPHRYVLDDAQMHIYMLMKKDSYPRFLKSDLYKNL 123
RGS_RGS7 cd08738
Regulator of G protein signaling (RGS) domain found in the RGS7 protein; The RGS (Regulator of ...
56-174 8.03e-23

Regulator of G protein signaling (RGS) domain found in the RGS7 protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS7 protein, a member of R7 subfamily of the RGS protein family. RGS is a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. Other members of the R7 subfamily (Neuronal RGS) include: RGS6, RGS9, and RGS11, all of which are expressed predominantly in the nervous system, form an obligatory complex with G-beta-5, and play important roles in the regulation of crucial neuronal processes such as vision and motor control. Additionally they have been implicated in many neurological conditions such as anxiety, schizophrenia, and drug dependence. R7 RGS proteins are key modulators of the pharmacological effects of drugs involved in the development of tolerance and addiction. In addition, RGS7 was found to bind a component of the synaptic fusion complex, snapin, and some other proteins outside of G protein signaling pathways.


Pssm-ID: 188692  Cd Length: 121  Bit Score: 90.55  E-value: 8.03e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  56 VKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKikSPSKLSP-RAKKIYNEFISVQQTKEVNLDSCTR 134
Cdd:cd08738    2 VKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKK--RPIREVPsRVQEIWQEFLAPGAPSAINLDSKSY 79
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 297747294 135 EETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08738   80 DKTTQNVKDPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAY 119
RGS_RGS12 cd08742
Regulator of G protein signaling (RGS) domain found in the RGS12 protein; RGS (Regulator of ...
63-174 2.63e-21

Regulator of G protein signaling (RGS) domain found in the RGS12 protein; RGS (Regulator of G-protein Signaling) domain is an essential part of the RGS12 protein. RGS12 is a member of the RA/RGS subfamily of RGS proteins family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS12 belong to the R12 RGS subfamily, which includes RGS10 and RGS14, all of which are highly selective for G-alpha-i1 over G-alpha-q. RGS12 exist in multiple splice variants: RGS12s (short) contains the core RGS/RBD/GoLoco domains, while RGS12L (long) has additional N-terminal PDZ and PTB domains. RGS12 splice variants show distinct expression patterns, suggesting that they have discrete functions during mouse embryogenesis. RGS12 also may play a critical role in coordinating Ras-dependent signals that are required for promoting and maintaining neuronal differentiation.


Pssm-ID: 188696  Cd Length: 115  Bit Score: 86.27  E-value: 2.63e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSK--LSPRAKKIYNEFISVQQTKEVNLDSctREETSRN 140
Cdd:cd08742    1 FERLLQDPVGVRYFSEFLRKEFSEENILFWQACEYFNHVPAHDKkeLSYRAREIFSKFLCSKATTPVNIDS--QAQLADD 78
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 297747294 141 MLE-PTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08742   79 ILNaPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLY 113
RGS_Axin cd08707
Regulator of G protein signaling (RGS) domain found in the Axin protein; The RGS (Regulator of ...
63-175 2.16e-13

Regulator of G protein signaling (RGS) domain found in the Axin protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the Axin protein. Axin is a member of the RA/RGS subfamily of the RGS protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, and skeletal and muscle development. The RGS domain of Axin is specifically interacts with the heterotrimeric G-alpha12 protein, but not with closely related G-alpha13, and provides a unique tool to regulate G-alpha12-mediated signaling processes. The RGS domain of Axin also interacts with the tumor suppressor protein APC (Adenomatous Polyposis Coli) in order to control the cytoplasmic level of the proto-oncogene, beta-catenin.


Pssm-ID: 188662  Cd Length: 117  Bit Score: 64.40  E-value: 2.16e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  63 LENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIK-SPSKLSPRAKKIYNEFISVQQTKEVNLDSCTR----EET 137
Cdd:cd08707    1 LHSLLDDQDGIELFRTYLEQEGCADLLDFWFACNGFRKMSdSEEKRSKLAKAIYRRYIKDNGIVSRQLKPATKsfikECI 80
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 297747294 138 SRNMLEPTItcFDEAQKKIFNLMEKDSYRRFLKSRFYL 175
Cdd:cd08707   81 KKQQLDPAM--FDQAQTEIQTTMEENTYPSFLKSDIYL 116
RGS-like_1 cd08734
Uncharacterized Regulator of G protein Signaling (RGS) domain subfamily, child 1; These ...
74-131 2.88e-09

Uncharacterized Regulator of G protein Signaling (RGS) domain subfamily, child 1; These uncharacterized RGS-like domains consists largely of hypothetical proteins. The RGS domain is an essential part of the Regulator of G-protein Signaling (RGS) protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory role as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. As a major G-protein regulator, the RGS domain containing proteins that are involved in many crucial cellular processes. RGS proteins play critical regulatory role as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, skeletal and muscle development, cell migration during early embryogenesis, as well as apoptosis, cell proliferation, and modulation of cardiac development. Several RGS proteins can fine-tune immune responses, while others play an important role in neuronal signal modulation. Some RGS proteins are the principal elements needed for proper vision.


Pssm-ID: 188688  Cd Length: 109  Bit Score: 52.47  E-value: 2.88e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 297747294  74 AAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQQTKEVNLDS 131
Cdd:cd08734    6 PLFGFSAESDFSGENLSFLTLVKEYKRLSNPAEKFTLASKIYKEFISSESPFQINISS 63
RGS_SNX13 cd08719
Regulator of G protein signaling (RGS) domain found in the Sorting Nexin 13 (SNX13) protein; ...
73-174 6.03e-09

Regulator of G protein signaling (RGS) domain found in the Sorting Nexin 13 (SNX13) protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the SNX13 (Sorting Nexin 13) protein, a member of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, skeletal and muscle development, cell migration during early embryogenesis, as well as apoptosis, cell proliferation, and modulation of cardiac development. The RGS-domain of SNX13 plays a major role through attenuation of Galphas-mediated signaling and regulates endocytic trafficking and degradation of the epidermal growth factor receptor. Snx13-null mice were embryonic lethal around midgestation which supports an essential role for SNX13 in mouse development and regulation of endocytosis dynamics.


Pssm-ID: 188674  Cd Length: 135  Bit Score: 52.03  E-value: 6.03e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  73 LAAFKAFLKSEYSEENIDFWISCEEYK-------------KIKSPSKLSPR-------AKKIYNEFISVQQTKEVNLDSC 132
Cdd:cd08719    8 LSYFIDFMQSVGGQAYLFFWLTVEGYRvsaeqqlselhlrQRGGEHQRSDVyemlraaALNIYDQYLSEKASPRVPLDDS 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 297747294 133 TREETSR--NMLEPTITCFDEAQKKIFNLMEKDS--YRRFLKSRFY 174
Cdd:cd08719   88 LVKKLLNrlRNDTPSDLWFDDIQQKVFDIMQEDErfYPAFKKSPAY 133
RGS_FLBA cd08708
Regulator of G protein signaling (RGS) domain found in the FLBA (Fluffy Low BrlA) protein; The ...
76-175 3.34e-07

Regulator of G protein signaling (RGS) domain found in the FLBA (Fluffy Low BrlA) protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the FLBA (Fluffy Low BrlA) protein. FLBA is a member of the RGS protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins play a critical regulatory role as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. Deactivation of the G-protein signaling controlled by the RGS domain accelerates the GTPase activity of the alpha subunit by hydrolysis of GTP to GDP which results in reassociation of the alpha-subunit with the beta-gamma-dimer and thereby inhibition of downstream activity. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes. The RGS domain of the FLBA protein antagonizes G protein signaling to block proliferation and allow development. It is required for control of mycelial proliferation and activation of asexual sporulation in yeast.


Pssm-ID: 188663  Cd Length: 148  Bit Score: 47.76  E-value: 3.34e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  76 FKAFLKSEYSEENIDFWISCEEYKK----------IKSPSKLSPRAKK--------IYNEFISVQQTKEVNLDSCTREET 137
Cdd:cd08708   15 FREHLEKEFCEENLSFYLEVKEFLKkmtilsklldFKSSQAADEDLDReslaqayhIYNTYLAPGSPCELNIDHNLRNRI 94
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297747294 138 SRNMLEP--------------TITCFDEAQKKIF-NLMEKDSYRRFLKSRFYL 175
Cdd:cd08708   95 TTIMTEKivgeddsmaeslqgVEALFEEAQNAVFkPLMAGDSVPKFLKQPEYL 147
RGS_AKAP2_2 cd08721
Regulator of G protein signaling (RGS) domain 2 found in the A-kinase anchoring protein, ...
70-174 3.84e-06

Regulator of G protein signaling (RGS) domain 2 found in the A-kinase anchoring protein, D-AKAP2; The RGS (Regulator of G-protein Signaling) domain is an essential part of the D-AKAP2 (A-kinase anchoring protein), a member of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, skeletal and muscle development, cell migration during early embryogenesis, as well as apoptosis, cell proliferation, and modulation of cardiac development. D-AKAP2 contains two RGS domains which play an important role in spatiotemporal localization of cAMP-dependent PKA (cyclic AMP-dependent protein kinase) that regulates many different signaling pathways by phosphorylation of target proteins. This cd contains the second RGS domain.


Pssm-ID: 188676  Cd Length: 121  Bit Score: 44.26  E-value: 3.84e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  70 ECGLAAFKAFLKSEYSEENIDFWISCEEYKKI-------KSPSKLSPRAKKIYNEFISVQQTKEVNLDSCTREETSRNML 142
Cdd:cd08721    5 ESALFYFMEYMEQEGARNLLQFWLAADNFQSQlaakegqYDGQQAQNDAMIIYDKYFSLQATEPLGFDDKTRLEVESNIC 84
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 297747294 143 E---PTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08721   85 ReggPLPSCFEAPLLQALTTLEQHYLPGFLSSQLY 119
RGS_SNX25 cd08720
Regulator of G protein signaling (RGS) domain found in the Sorting Nexin 25 (SNX25) protein; ...
76-174 1.43e-03

Regulator of G protein signaling (RGS) domain found in the Sorting Nexin 25 (SNX25) protein; The RGS (Regulator of G-protein Signaling) domain is an essential part of the SNX25 (Sorting Nexin 25) protein, a member of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, skeletal and muscle development, cell migration during early embryogenesis, as well as apoptosis, cell proliferation, and modulation of cardiac development. SNX25 is a member of the Dopamine receptors (DAR) signalplex and regulates the trafficking of D1 and D2 DARs.


Pssm-ID: 188675  Cd Length: 110  Bit Score: 37.01  E-value: 1.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  76 FKAFLKSEYSEENIDFWISCEEYKKiKSPSKLSPRAKKIYNEFIsVQQTKEVNLDSCTREETSRNML-EPTITCFDEAQK 154
Cdd:cd08720   11 LSQFLERMDSQALIGFWEAVEELRS-ANKSEWHQLGAEIFYTFI-VEPTAEIKVDKSLRKRIEQFLLgDKGPEVFYEVQE 88
                         90       100
                 ....*....|....*....|
gi 297747294 155 KIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08720   89 NVVETLEEKYYPSFVVSDQY 108
RGS_RGS22_1 cd08731
Regulator of G protein signaling domain RGS_RGS22_1; The RGS (Regulator of G-protein Signaling) ...
70-174 2.04e-03

Regulator of G protein signaling domain RGS_RGS22_1; The RGS (Regulator of G-protein Signaling) domain found in the RGS22 protein, a member of the RA/RGS subfamily of the RGS protein family, which is a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory role as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, skeletal and muscle development, cell migration during early embryogenesis, as well as apoptosis, cell proliferation, and modulation of cardiac development. RGS22 contains at least 3 copies of the RGS domain in vertebrata and exists in multiple splicing variants. RGS22 is predominantly expressed in testis and believed to play an important role in spermatogenesis.


Pssm-ID: 188686  Cd Length: 125  Bit Score: 36.55  E-value: 2.04e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297747294  70 ECGLAAFKAFLKSEYSEENIDFWISCEEYKKiKSPSKLSPRAKKIYNeFISVQQTK-EVNLDSCTREET-----SRNMLE 143
Cdd:cd08731    5 EQGLEVFKAFLLNTRGEKLFVFWLDVEPYKA-KDKVEAYLQSKRIFA-KYQVASTKrELLPPSAEPLRTrvlnaAAKKLE 82
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 297747294 144 PTI-TCFDEAQKKIFNLME---KDSYRRFLKSRFY 174
Cdd:cd08731   83 PKInKNFARIQLDIFRGLEslvLDHMTRTAFPQFL 117
RGS_AKAP2_1 cd08735
Regulator of G protein signaling (RGS) domain 1 found in the A-kinase anchoring protein, ...
148-174 2.58e-03

Regulator of G protein signaling (RGS) domain 1 found in the A-kinase anchoring protein, D-AKAP2; The RGS (Regulator of G-protein Signaling) domain is an essential part of the D-AKAP2 (A-kinase anchoring protein), a member of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, skeletal and muscle development, cell migration during early embryogenesis, as well as apoptosis, cell proliferation, and modulation of cardiac development. D-AKAP2 contains two RGS domains which play an important role in spatiotemporal localization of cAMP-dependent PKA (cyclic AMP-dependent protein kinase) that regulates many different signaling pathways by phosphorylation of target proteins. This cd contains the first RGS domain.


Pssm-ID: 188689  Cd Length: 171  Bit Score: 37.05  E-value: 2.58e-03
                         10        20
                 ....*....|....*....|....*..
gi 297747294 148 CFDEAQKKIFNLMEKDSYRRFLKSRFY 174
Cdd:cd08735  143 CFVEAQSFVFSAMEQDHFTEFLRSHFF 169
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH