NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|28871879|ref|NP_794498|]
View 

hypothetical protein PSPTO_4763 [[Pseudomonas syringae] pv. tomato str. DC3000]

Protein Classification

protein phosphatase 2C domain-containing protein (domain architecture ID 10615397)

protein phosphatase 2C domain-containing protein similar to Escherichia coli YegK. Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
18-236 9.24e-62

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


:

Pssm-ID: 290397  Cd Length: 209  Bit Score: 195.61  E-value: 9.24e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28871879    18 TGRAHLKSDMPCQDYAAARIERDIACIALADGAGSRAYSADGARVVVRAVSRALVDGFEEIWALSEVKPSQASERLLAHc 97
Cdd:pfam13672   1 RGTSHIRRGLPCQDAFAVWVLSGGSLIAVADGAGSAKLSDVGARIAVEAAVEALADLLESEEEEIEALLRAILNDWLAL- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28871879    98 kvaLESQAIKMQCEVPDLACTLLFVAHSKGRYLAGHVGDGCIVQQRTDGEIVVLSHPDNGEYANTTFFMTDSTVHSHFRL 177
Cdd:pfam13672  80 ---VKEEAEARGLEPRDYATTLLAAVVTPGGIVFFQIGDGAIVVRDRDGEVQVLSQPDSGEYANETTFLTSEDALDELRI 156
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 28871879   178 YRGESGADSGFVIMSDGTAESLYRRfdklpaTSAVRKIIAWCSTATPKAMRDVLAGNLE 236
Cdd:pfam13672 157 RRLPLEPGDALALMTDGLANSLVDE------EPFVPFFAPLFRTLEKEGAAEQLVDFLE 209
 
Name Accession Description Interval E-value
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
18-236 9.24e-62

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 290397  Cd Length: 209  Bit Score: 195.61  E-value: 9.24e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28871879    18 TGRAHLKSDMPCQDYAAARIERDIACIALADGAGSRAYSADGARVVVRAVSRALVDGFEEIWALSEVKPSQASERLLAHc 97
Cdd:pfam13672   1 RGTSHIRRGLPCQDAFAVWVLSGGSLIAVADGAGSAKLSDVGARIAVEAAVEALADLLESEEEEIEALLRAILNDWLAL- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28871879    98 kvaLESQAIKMQCEVPDLACTLLFVAHSKGRYLAGHVGDGCIVQQRTDGEIVVLSHPDNGEYANTTFFMTDSTVHSHFRL 177
Cdd:pfam13672  80 ---VKEEAEARGLEPRDYATTLLAAVVTPGGIVFFQIGDGAIVVRDRDGEVQVLSQPDSGEYANETTFLTSEDALDELRI 156
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 28871879   178 YRGESGADSGFVIMSDGTAESLYRRfdklpaTSAVRKIIAWCSTATPKAMRDVLAGNLE 236
Cdd:pfam13672 157 RRLPLEPGDALALMTDGLANSLVDE------EPFVPFFAPLFRTLEKEGAAEQLVDFLE 209
 
Name Accession Description Interval E-value
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
18-236 9.24e-62

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 290397  Cd Length: 209  Bit Score: 195.61  E-value: 9.24e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28871879    18 TGRAHLKSDMPCQDYAAARIERDIACIALADGAGSRAYSADGARVVVRAVSRALVDGFEEIWALSEVKPSQASERLLAHc 97
Cdd:pfam13672   1 RGTSHIRRGLPCQDAFAVWVLSGGSLIAVADGAGSAKLSDVGARIAVEAAVEALADLLESEEEEIEALLRAILNDWLAL- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28871879    98 kvaLESQAIKMQCEVPDLACTLLFVAHSKGRYLAGHVGDGCIVQQRTDGEIVVLSHPDNGEYANTTFFMTDSTVHSHFRL 177
Cdd:pfam13672  80 ---VKEEAEARGLEPRDYATTLLAAVVTPGGIVFFQIGDGAIVVRDRDGEVQVLSQPDSGEYANETTFLTSEDALDELRI 156
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 28871879   178 YRGESGADSGFVIMSDGTAESLYRRfdklpaTSAVRKIIAWCSTATPKAMRDVLAGNLE 236
Cdd:pfam13672 157 RRLPLEPGDALALMTDGLANSLVDE------EPFVPFFAPLFRTLEKEGAAEQLVDFLE 209
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH