NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|28571872|ref|NP_651323|]
View 

Protein Classification

emp24/gp25L/p24 family protein (domain architecture ID 10471359)

emp24/gp25L/p24 family protein such as various transmembrane emp24 domain-containing proteins, which are involved in vesicular protein trafficking

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
EMP24_GP25L pfam01105
emp24/gp25L/p24 family/GOLD; Members of this family are implicated in bringing cargo forward ...
20-200 3.61e-50

emp24/gp25L/p24 family/GOLD; Members of this family are implicated in bringing cargo forward from the ER and binding to coat proteins by their cytoplasmic domains. This domain corresponds closely to the beta-strand rich GOLD domain described in. The GOLD domain is always found combined with lipid- or membrane-association domains.


:

Pssm-ID: 334385  Cd Length: 181  Bit Score: 160.55  E-value: 3.61e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28571872    20 AVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARDTKG---HILSQKEHITKGKFSFMSEVYDTYEICFIS 96
Cdd:pfam01105   1 ALTFELPAGEKECFYEEVPKGTLVTGSYQVISGGGLDVDFTITDPDGngnVIVSKKDKKSGGDFSFTATESGEYKFCFDN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28571872    97 KvpaHQRGVIQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFF 176
Cdd:pfam01105  81 S---FSTFSSKTVSFDIKVGSEAKDYDDVAKKEKLDPLEESLRKLEDQLNSIKREQKYLREREARHRDTNESTNSRVVWW 157
                         170       180
                  ....*....|....*....|....
gi 28571872   177 SIFSMCCLLGLATWQVLYLRRYFK 200
Cdd:pfam01105 158 SIIQLLVLIGVSVLQVYYLKRFFE 181
 
Name Accession Description Interval E-value
EMP24_GP25L pfam01105
emp24/gp25L/p24 family/GOLD; Members of this family are implicated in bringing cargo forward ...
20-200 3.61e-50

emp24/gp25L/p24 family/GOLD; Members of this family are implicated in bringing cargo forward from the ER and binding to coat proteins by their cytoplasmic domains. This domain corresponds closely to the beta-strand rich GOLD domain described in. The GOLD domain is always found combined with lipid- or membrane-association domains.


Pssm-ID: 334385  Cd Length: 181  Bit Score: 160.55  E-value: 3.61e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28571872    20 AVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARDTKG---HILSQKEHITKGKFSFMSEVYDTYEICFIS 96
Cdd:pfam01105   1 ALTFELPAGEKECFYEEVPKGTLVTGSYQVISGGGLDVDFTITDPDGngnVIVSKKDKKSGGDFSFTATESGEYKFCFDN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28571872    97 KvpaHQRGVIQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFF 176
Cdd:pfam01105  81 S---FSTFSSKTVSFDIKVGSEAKDYDDVAKKEKLDPLEESLRKLEDQLNSIKREQKYLREREARHRDTNESTNSRVVWW 157
                         170       180
                  ....*....|....*....|....
gi 28571872   177 SIFSMCCLLGLATWQVLYLRRYFK 200
Cdd:pfam01105 158 SIIQLLVLIGVSVLQVYYLKRFFE 181
 
Name Accession Description Interval E-value
EMP24_GP25L pfam01105
emp24/gp25L/p24 family/GOLD; Members of this family are implicated in bringing cargo forward ...
20-200 3.61e-50

emp24/gp25L/p24 family/GOLD; Members of this family are implicated in bringing cargo forward from the ER and binding to coat proteins by their cytoplasmic domains. This domain corresponds closely to the beta-strand rich GOLD domain described in. The GOLD domain is always found combined with lipid- or membrane-association domains.


Pssm-ID: 334385  Cd Length: 181  Bit Score: 160.55  E-value: 3.61e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28571872    20 AVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARDTKG---HILSQKEHITKGKFSFMSEVYDTYEICFIS 96
Cdd:pfam01105   1 ALTFELPAGEKECFYEEVPKGTLVTGSYQVISGGGLDVDFTITDPDGngnVIVSKKDKKSGGDFSFTATESGEYKFCFDN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28571872    97 KvpaHQRGVIQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFF 176
Cdd:pfam01105  81 S---FSTFSSKTVSFDIKVGSEAKDYDDVAKKEKLDPLEESLRKLEDQLNSIKREQKYLREREARHRDTNESTNSRVVWW 157
                         170       180
                  ....*....|....*....|....
gi 28571872   177 SIFSMCCLLGLATWQVLYLRRYFK 200
Cdd:pfam01105 158 SIIQLLVLIGVSVLQVYYLKRFFE 181
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH