NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|284447335|ref|NP_001165196|]
View 

guanine nucleotide binding protein (G protein), gamma 7 L homeolog [Xenopus laevis]

Protein Classification

GGL domain-containing protein (domain architecture ID 11260168)

GGL domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GGL smart00224
G protein gamma subunit-like motifs;
7-68 1.56e-27

G protein gamma subunit-like motifs;


:

Pssm-ID: 128520  Cd Length: 63  Bit Score: 96.58  E-value: 1.56e-27
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 284447335    7 IAQARKLVEQLRLEAGIERVKISKAAADLMNYCEQHAKNDPLLVGVPTSENPFK-DKKPCSIL 68
Cdd:smart00224  1 KDQLRKEVEQLRKELSRERIKVSKAAEELLAYCEQHAEEDPLLTGPPPSKNPFIeDKTSCWIL 63
 
Name Accession Description Interval E-value
GGL smart00224
G protein gamma subunit-like motifs;
7-68 1.56e-27

G protein gamma subunit-like motifs;


Pssm-ID: 128520  Cd Length: 63  Bit Score: 96.58  E-value: 1.56e-27
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 284447335    7 IAQARKLVEQLRLEAGIERVKISKAAADLMNYCEQHAKNDPLLVGVPTSENPFK-DKKPCSIL 68
Cdd:smart00224  1 KDQLRKEVEQLRKELSRERIKVSKAAEELLAYCEQHAEEDPLLTGPPPSKNPFIeDKTSCWIL 63
GGL cd00068
G protein gamma subunit-like motifs, the alpha-helical G-gamma chain dimerizes with the G-beta ...
7-63 2.35e-24

G protein gamma subunit-like motifs, the alpha-helical G-gamma chain dimerizes with the G-beta propeller subunit as part of the heterotrimeric G-protein complex; involved in signal transduction via G-protein-coupled receptors


Pssm-ID: 238024  Cd Length: 57  Bit Score: 88.11  E-value: 2.35e-24
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 284447335  7 IAQARKLVEQLRLEAGIERVKISKAAADLMNYCEQHAKNDPLLVGVPTSENPFKDKK 63
Cdd:cd00068   1 VDQLKKEVEQLRKELSRERLKVSKAAAELLKYCEQNAENDPLLTGPPSPSNPWIEKK 57
G-gamma pfam00631
GGL domain; G-protein gamma like domains (GGL) are found in the gamma subunit of the ...
9-68 1.34e-19

GGL domain; G-protein gamma like domains (GGL) are found in the gamma subunit of the heterotrimeric G protein complex and in regulators of G protein signaling (RGS) proteins. It is also found fused to an inactive Galpha in the Dictyostelium protein gbqA. G-gamma likely shares a common origin with the helical N-terminal unit of G-beta. All organisms that posses a G-beta possess a G-gamma.


Pssm-ID: 306979  Cd Length: 68  Bit Score: 76.22  E-value: 1.34e-19
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 284447335   9 QARKLVEQLRLEAGIERVKISKAAADLMNYCEQHAKNDPLLVGV--PTSENPFK-DKKPCSIL 68
Cdd:pfam00631  6 RLKREIEQLKEELKRERIKVSKACEELIKYCEQRSTKDPLLPGVwpPAGENPWIeKDGCCWIL 68
 
Name Accession Description Interval E-value
GGL smart00224
G protein gamma subunit-like motifs;
7-68 1.56e-27

G protein gamma subunit-like motifs;


Pssm-ID: 128520  Cd Length: 63  Bit Score: 96.58  E-value: 1.56e-27
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 284447335    7 IAQARKLVEQLRLEAGIERVKISKAAADLMNYCEQHAKNDPLLVGVPTSENPFK-DKKPCSIL 68
Cdd:smart00224  1 KDQLRKEVEQLRKELSRERIKVSKAAEELLAYCEQHAEEDPLLTGPPPSKNPFIeDKTSCWIL 63
GGL cd00068
G protein gamma subunit-like motifs, the alpha-helical G-gamma chain dimerizes with the G-beta ...
7-63 2.35e-24

G protein gamma subunit-like motifs, the alpha-helical G-gamma chain dimerizes with the G-beta propeller subunit as part of the heterotrimeric G-protein complex; involved in signal transduction via G-protein-coupled receptors


Pssm-ID: 238024  Cd Length: 57  Bit Score: 88.11  E-value: 2.35e-24
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 284447335  7 IAQARKLVEQLRLEAGIERVKISKAAADLMNYCEQHAKNDPLLVGVPTSENPFKDKK 63
Cdd:cd00068   1 VDQLKKEVEQLRKELSRERLKVSKAAAELLKYCEQNAENDPLLTGPPSPSNPWIEKK 57
G-gamma pfam00631
GGL domain; G-protein gamma like domains (GGL) are found in the gamma subunit of the ...
9-68 1.34e-19

GGL domain; G-protein gamma like domains (GGL) are found in the gamma subunit of the heterotrimeric G protein complex and in regulators of G protein signaling (RGS) proteins. It is also found fused to an inactive Galpha in the Dictyostelium protein gbqA. G-gamma likely shares a common origin with the helical N-terminal unit of G-beta. All organisms that posses a G-beta possess a G-gamma.


Pssm-ID: 306979  Cd Length: 68  Bit Score: 76.22  E-value: 1.34e-19
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 284447335   9 QARKLVEQLRLEAGIERVKISKAAADLMNYCEQHAKNDPLLVGV--PTSENPFK-DKKPCSIL 68
Cdd:pfam00631  6 RLKREIEQLKEELKRERIKVSKACEELIKYCEQRSTKDPLLPGVwpPAGENPWIeKDGCCWIL 68
proteasome_alpha_archeal cd03756
proteasome_alpha_archeal. The 20S proteasome, multisubunit proteolytic complex, is the central ...
2-42 5.99e-03

proteasome_alpha_archeal. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.


Pssm-ID: 239725  Cd Length: 211  Bit Score: 33.07  E-value: 5.99e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 284447335   2 STSNNIAQARKLVEQLRLEAGIERVK---------ISKAAADLMNYCEQH 42
Cdd:cd03756   71 ATSGLVADARVLIDRARVEAQIHRLTygepidvevLVKKICDLKQQYTQH 120
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH