NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27382057|ref|NP_773586|]
View 

methyl-accepting chemotaxis protein [Bradyrhizobium diazoefficiens USDA 110]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCPsignal super family cl28165
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
459-712 1.07e-40

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


The actual alignment was detected with superfamily member smart00283:

Pssm-ID: 332985  Cd Length: 262  Bit Score: 150.90  E-value: 1.07e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    459 DISSSARQLEAAASTLSRNAEATGDLTTAVAGASREAVGSIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQARDTD 538
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    539 VRIAALSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQGMQQAT 618
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    619 GESIAAIKTIAGTIGEISSISG-------SIATAVDQQTTTTQEIARSAQHAASGTGQVSTNLEQVNREATETGAAASAV 691
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEetgdaleEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|.
gi 27382057    692 LQSARGLTEASQRLRVELDGF 712
Cdd:smart00283 241 SAAAEELSGLAEELDELVERF 261
PRK15347 super family cl28304
two component system sensor kinase SsrA; Provisional
327-419 5.27e-03

two component system sensor kinase SsrA; Provisional


The actual alignment was detected with superfamily member TIGR02956:

Pssm-ID: 333124  Cd Length: 968  Bit Score: 40.15  E-value: 5.27e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057   327 LAEQAEAekKTSEQIASGQSVVVALA-LASIAIGLVLSFAVGRGIARPVIAMCAAMTELARGRHEIVLPGLGRrDEVGKM 405
Cdd:TIGR02956 314 RTEAAVS--DLLMTLSVAQFGLLITGmLGLVILVFIMWRVVYRSVILRLNQHTQALLRLALGDLDISLDARGD-DELAHM 390
                          90
                  ....*....|....
gi 27382057   406 AGAVEMFKRQAIER 419
Cdd:TIGR02956 391 GRAIEAFRDTAAHN 404
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
459-712 1.07e-40

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 150.90  E-value: 1.07e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    459 DISSSARQLEAAASTLSRNAEATGDLTTAVAGASREAVGSIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQARDTD 538
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    539 VRIAALSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQGMQQAT 618
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    619 GESIAAIKTIAGTIGEISSISG-------SIATAVDQQTTTTQEIARSAQHAASGTGQVSTNLEQVNREATETGAAASAV 691
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEetgdaleEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|.
gi 27382057    692 LQSARGLTEASQRLRVELDGF 712
Cdd:smart00283 241 SAAAEELSGLAEELDELVERF 261
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
498-684 9.06e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 132.36  E-value: 9.06e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 498 SIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQARDTDVR-------IAALSEASHRIGDVVKLITAVAEQTNLLAL 570
Cdd:cd11386   6 SIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESvdeavsaVEELEESSAEIGEIVEVIDDIAEQTNLLAL 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 571 NATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQGMQQATGESIAAIKTIAGTIGEISSISGSIATAVDQQT 650
Cdd:cd11386  86 NAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIV 165
                       170       180       190
                ....*....|....*....|....*....|....
gi 27382057 651 TTTQEIARSAQHAASGTGQVSTNLEQVNREATET 684
Cdd:cd11386 166 ASVEEVADGIQEISAATQEQSASTQEIAAAVEEI 199
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
330-712 1.62e-34

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 137.04  E-value: 1.62e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 330 QAEAEKKTSEQIASGQSVVVALALASIAIGLVLSFAVGRGIARPVIAMCAAMTELARGRHeIVLPGLGRRDEVGKMAGAV 409
Cdd:COG0840  44 LDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDL-TKRIDESSNDEFGQLAKSF 122
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 410 emfkrqaiertereaaeieerNRSAAELRrseltrfagTFETAVGDIVNDISSSARQLEAAASTLSRNAEATGDLTTAVA 489
Cdd:COG0840 123 ---------------------NEMILNLR---------QIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVA 172
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 490 GASREAVGSIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQ----ARDTDVRIAALSEASHRIGDVVKLITAVAEQT 565
Cdd:COG0840 173 SAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQmqeiAEELAEVVKKLSESSQEIEEITSVINSIAEQT 252
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 566 NLLALNATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQGMQQATGESIAAIKTIA-------GTIGEISSI 638
Cdd:COG0840 253 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESAsevsegvKLVEETGSS 332
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27382057 639 SGSIATAVDQQTTTTQEIARSAQHAASGTGQVSTNLEQVNREATETGAAASAVLQSARGLTEASQRLRVELDGF 712
Cdd:COG0840 333 LGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
506-712 1.37e-27

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 112.16  E-value: 1.37e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057   506 AEELSLSINEIRSQVRNSNDISESAVQQARDtdvriaaLSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRG 585
Cdd:pfam00015   1 SDLAQLASEEALDEMSQIGQVVDDAVETMEE-------LETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRG 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057   586 FAVVASEVKSLASQTARATEEIGAHIQGMQQATGESIAAIKTIAGTIGEISSISGS-------IATAVDQQTTTTQEIAR 658
Cdd:pfam00015  74 FAVVADEVRKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVEStgealkeIVEAVAEIADIVQEIAA 153
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 27382057   659 SAQHAASGTGQVSTNLEQVNREATETGAAASAVLQSARGLTEASQRLRVELDGF 712
Cdd:pfam00015 154 ASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
311-711 5.24e-26

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 112.79  E-value: 5.24e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  311 LRHSLSGAASSLKRVA--LAEQAEAEKKTSEQIASGQSVVVALALASIAIglVLSFAVGRGIARPVIAMCAAMTELARGR 388
Cdd:PRK15048 157 MQNAMGEAFAQYALSSekLYRDIVTDNADDYRFAQWQLAVIALVVVLILL--VAWYGIRRMLLTPLAKIIAHIREIAGGN 234
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  389 HEIVLPGLGRrDEVGKMAGAVEMFKRQAIErtereaaeieernrSAAELRRSELTRFAGTFETAVGDivNDISSSARQLE 468
Cdd:PRK15048 235 LANTLTIDGR-SEMGDLAQSVSHMQRSLTD--------------TVTHVREGSDAIYAGTREIAAGN--TDLSSRTEQQA 297
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  469 AAastlsrnaeatgdlttavagasreavgsIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQAR------DTDVR-I 541
Cdd:PRK15048 298 SA----------------------------LEETAASMEQLTATVKQNADNARQASQLAQSASDTAQhggkvvDGVVKtM 349
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  542 AALSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQG-------- 613
Cdd:PRK15048 350 HEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDsvsrvdtg 429
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  614 --MQQATGES----IAAIKTIAGTIGEISSISGSIATAVDQQTTTTQEIARSAQHAASGTGQVSTNLEQVNREATETGAA 687
Cdd:PRK15048 430 svLVESAGETmnniVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQA 509
                        410       420
                 ....*....|....*....|....
gi 27382057  688 ASAVLQSARGLTEASQRLRVELDG 711
Cdd:PRK15048 510 VSAFRLAASPLTNKPQTPSRPASE 533
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
327-419 5.27e-03

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362  Cd Length: 968  Bit Score: 40.15  E-value: 5.27e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057   327 LAEQAEAekKTSEQIASGQSVVVALA-LASIAIGLVLSFAVGRGIARPVIAMCAAMTELARGRHEIVLPGLGRrDEVGKM 405
Cdd:TIGR02956 314 RTEAAVS--DLLMTLSVAQFGLLITGmLGLVILVFIMWRVVYRSVILRLNQHTQALLRLALGDLDISLDARGD-DELAHM 390
                          90
                  ....*....|....
gi 27382057   406 AGAVEMFKRQAIER 419
Cdd:TIGR02956 391 GRAIEAFRDTAAHN 404
HAMP pfam00672
HAMP domain;
348-410 5.69e-03

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 36.78  E-value: 5.69e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 27382057   348 VVALALASIAIGLVLSFAVGRGIARPVIAMCAAMTELARGRHEIVLPglGRRDEVGKMAGAVE 410
Cdd:pfam00672   1 LLLVLLIALLLALLLAWLLARRILRPLRRLAEAARRIASGDLDVPLE--SGRDEIGELARAFN 61
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
459-712 1.07e-40

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 150.90  E-value: 1.07e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    459 DISSSARQLEAAASTLSRNAEATGDLTTAVAGASREAVGSIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQARDTD 538
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    539 VRIAALSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQGMQQAT 618
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057    619 GESIAAIKTIAGTIGEISSISG-------SIATAVDQQTTTTQEIARSAQHAASGTGQVSTNLEQVNREATETGAAASAV 691
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEetgdaleEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|.
gi 27382057    692 LQSARGLTEASQRLRVELDGF 712
Cdd:smart00283 241 SAAAEELSGLAEELDELVERF 261
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
498-684 9.06e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 132.36  E-value: 9.06e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 498 SIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQARDTDVR-------IAALSEASHRIGDVVKLITAVAEQTNLLAL 570
Cdd:cd11386   6 SIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESvdeavsaVEELEESSAEIGEIVEVIDDIAEQTNLLAL 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 571 NATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQGMQQATGESIAAIKTIAGTIGEISSISGSIATAVDQQT 650
Cdd:cd11386  86 NAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIV 165
                       170       180       190
                ....*....|....*....|....*....|....
gi 27382057 651 TTTQEIARSAQHAASGTGQVSTNLEQVNREATET 684
Cdd:cd11386 166 ASVEEVADGIQEISAATQEQSASTQEIAAAVEEI 199
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
330-712 1.62e-34

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 137.04  E-value: 1.62e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 330 QAEAEKKTSEQIASGQSVVVALALASIAIGLVLSFAVGRGIARPVIAMCAAMTELARGRHeIVLPGLGRRDEVGKMAGAV 409
Cdd:COG0840  44 LDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDL-TKRIDESSNDEFGQLAKSF 122
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 410 emfkrqaiertereaaeieerNRSAAELRrseltrfagTFETAVGDIVNDISSSARQLEAAASTLSRNAEATGDLTTAVA 489
Cdd:COG0840 123 ---------------------NEMILNLR---------QIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVA 172
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 490 GASREAVGSIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQ----ARDTDVRIAALSEASHRIGDVVKLITAVAEQT 565
Cdd:COG0840 173 SAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQmqeiAEELAEVVKKLSESSQEIEEITSVINSIAEQT 252
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 566 NLLALNATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQGMQQATGESIAAIKTIA-------GTIGEISSI 638
Cdd:COG0840 253 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESAsevsegvKLVEETGSS 332
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27382057 639 SGSIATAVDQQTTTTQEIARSAQHAASGTGQVSTNLEQVNREATETGAAASAVLQSARGLTEASQRLRVELDGF 712
Cdd:COG0840 333 LGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
506-712 1.37e-27

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 112.16  E-value: 1.37e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057   506 AEELSLSINEIRSQVRNSNDISESAVQQARDtdvriaaLSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRG 585
Cdd:pfam00015   1 SDLAQLASEEALDEMSQIGQVVDDAVETMEE-------LETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRG 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057   586 FAVVASEVKSLASQTARATEEIGAHIQGMQQATGESIAAIKTIAGTIGEISSISGS-------IATAVDQQTTTTQEIAR 658
Cdd:pfam00015  74 FAVVADEVRKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVEStgealkeIVEAVAEIADIVQEIAA 153
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 27382057   659 SAQHAASGTGQVSTNLEQVNREATETGAAASAVLQSARGLTEASQRLRVELDGF 712
Cdd:pfam00015 154 ASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
311-711 5.24e-26

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 112.79  E-value: 5.24e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  311 LRHSLSGAASSLKRVA--LAEQAEAEKKTSEQIASGQSVVVALALASIAIglVLSFAVGRGIARPVIAMCAAMTELARGR 388
Cdd:PRK15048 157 MQNAMGEAFAQYALSSekLYRDIVTDNADDYRFAQWQLAVIALVVVLILL--VAWYGIRRMLLTPLAKIIAHIREIAGGN 234
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  389 HEIVLPGLGRrDEVGKMAGAVEMFKRQAIErtereaaeieernrSAAELRRSELTRFAGTFETAVGDivNDISSSARQLE 468
Cdd:PRK15048 235 LANTLTIDGR-SEMGDLAQSVSHMQRSLTD--------------TVTHVREGSDAIYAGTREIAAGN--TDLSSRTEQQA 297
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  469 AAastlsrnaeatgdlttavagasreavgsIRSVAAAAEELSLSINEIRSQVRNSNDISESAVQQAR------DTDVR-I 541
Cdd:PRK15048 298 SA----------------------------LEETAASMEQLTATVKQNADNARQASQLAQSASDTAQhggkvvDGVVKtM 349
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  542 AALSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRGFAVVASEVKSLASQTARATEEIGAHIQG-------- 613
Cdd:PRK15048 350 HEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDsvsrvdtg 429
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  614 --MQQATGES----IAAIKTIAGTIGEISSISGSIATAVDQQTTTTQEIARSAQHAASGTGQVSTNLEQVNREATETGAA 687
Cdd:PRK15048 430 svLVESAGETmnniVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQA 509
                        410       420
                 ....*....|....*....|....
gi 27382057  688 ASAVLQSARGLTEASQRLRVELDG 711
Cdd:PRK15048 510 VSAFRLAASPLTNKPQTPSRPASE 533
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
432-694 2.67e-23

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 104.38  E-value: 2.67e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  432 RSAAELRRSELTRFAGTFETAVGDIVNDISSSARQLEAAASTLSRNAEATGDLTTAvagaSREAVGSIRSVAAAAEELSL 511
Cdd:PRK09793 235 RPIAVYGRNEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSR----TEQQAASLAQTAASMEQLTA 310
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  512 SINEIRSQVRNSNDISESAVQQARDTDVRIAALSE-------ASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGR 584
Cdd:PRK09793 311 TVGQNADNARQASELAKNAATTAQAGGVQVSTMTHtmqeiatSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGR 390
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  585 GFAVVASEVKSLASQTARATEEIGAHIQG----MQQATGESIAAIKT---IAGTIGEISSISGSIATAVDQQTTTTQEIA 657
Cdd:PRK09793 391 GFAVVAGEVRNLASRSAQAAKEIKGLIEEsvnrVQQGSKLVNNAAATmtdIVSSVTRVNDIMGEIASASEEQRRGIEQVA 470
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 27382057  658 RsaqhAASGTGQVStnleQVNREATETGAAASAVLQS 694
Cdd:PRK09793 471 Q----AVSQMDQVT----QQNASLVEEAAVATEQLAN 499
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
432-708 4.97e-23

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 103.50  E-value: 4.97e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  432 RSAAELRRSELTRFAGTFETAVGDivNDISSSARQleaAASTLSRNAEATGDLTTAVAGASREAvgsirsvaAAAEELSL 511
Cdd:PRK15041 265 RTVGDVRNGANAIYSGASEIATGN--NDLSSRTEQ---QAASLEETAASMEQLTATVKQNAENA--------RQASHLAL 331
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  512 SINEirsQVRNSNDISESAVQQARDtdvriaaLSEASHRIGDVVKLITAVAEQTNLLALNATIEAARAGDAGRGFAVVAS 591
Cdd:PRK15041 332 SASE---TAQRGGKVVDNVVQTMRD-------ISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG 401
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057  592 EVKSLASQTARATEEIGAHIQgmqqatgESIAAIKTIAGTIGEISSISGSIATAVDQQTTTTQEIARSAQHAASGTGQVS 671
Cdd:PRK15041 402 EVRNLAQRSAQAAREIKSLIE-------DSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVG 474
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 27382057  672 TNLEQVNREAT-------ETGAAASAVLQSARGLTEASQRLRVE 708
Cdd:PRK15041 475 LAVAEMDRVTQqnaalveESAAAAAALEEQASRLTEAVAVFRIQ 518
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
501-716 6.13e-04

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 42.67  E-value: 6.13e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 501 SVAAAAEELSLSINEIRSQVRNSNDISESAVQQARDTDVRIAALSEASHRIGDVVKLITAVAE----QTNLLALNATIEA 576
Cdd:COG0840  18 EADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLlraiLEPISDLLEVVER 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057 577 ARAGDAGRGFAVVAS-EVKSLASQTARATEEIGAHIQGMQQATGESIAAIKTIAGTIGEISSISGSIATAVDQQTTTTQE 655
Cdd:COG0840  98 IAAGDLTKRIDESSNdEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEE 177
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27382057 656 IARSAQHAASGTGQVSTNLEQVNREATETGAAASAVLQSARGLTEASQRLRVELDGFMANV 716
Cdd:COG0840 178 LSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEI 238
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
327-419 5.27e-03

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362  Cd Length: 968  Bit Score: 40.15  E-value: 5.27e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27382057   327 LAEQAEAekKTSEQIASGQSVVVALA-LASIAIGLVLSFAVGRGIARPVIAMCAAMTELARGRHEIVLPGLGRrDEVGKM 405
Cdd:TIGR02956 314 RTEAAVS--DLLMTLSVAQFGLLITGmLGLVILVFIMWRVVYRSVILRLNQHTQALLRLALGDLDISLDARGD-DELAHM 390
                          90
                  ....*....|....
gi 27382057   406 AGAVEMFKRQAIER 419
Cdd:TIGR02956 391 GRAIEAFRDTAAHN 404
HAMP pfam00672
HAMP domain;
348-410 5.69e-03

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 36.78  E-value: 5.69e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 27382057   348 VVALALASIAIGLVLSFAVGRGIARPVIAMCAAMTELARGRHEIVLPglGRRDEVGKMAGAVE 410
Cdd:pfam00672   1 LLLVLLIALLLALLLAWLLARRILRPLRRLAEAARRIASGDLDVPLE--SGRDEIGELARAFN 61
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH