NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27379302|ref|NP_770831|]
View 

hypothetical protein blr4191 [Bradyrhizobium diazoefficiens USDA 110]

Protein Classification

FIST and FIST_C domain-containing protein (domain architecture ID 12222825)

protein containing domains FIST, FIST_C, and MCP_signal

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FIST smart00897
FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal ...
60-264 6.45e-35

FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


:

Pssm-ID: 214894  Cd Length: 196  Bit Score: 132.44  E-value: 6.45e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302     60 LVLAFISPHCDFARVASSLQ-RLAGSTPVIAMSTAGELCSAgqslykptgsnwssvVVQVLPADLFQSVSIHSVRLHNDD 138
Cdd:smart00897   4 LVLFFSSPAYDAEALLAALReRFPGATPIVGCSTAGEITTG---------------VVQEFEDEPALSVMLFELPLVSFD 68
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    139 IRKGepsrahDARIEAITREVAAIRTPFAIDVRDTIAFALVDGVSAS-ESYFMEAVYRSGKFPCGFVGGSAGGKLDFQHT 217
Cdd:smart00897  69 VFSL------VDPLPDLVAGLLLAALLAAIDPRNTFALLLLDDLSSSnEEELLEGLDEALPEGIPIGGGSAGDNLRFQET 142
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 27379302    218 HLYDGRQVLENHALIVFMklaPGRAYGIFKTQNFKKTGKSFVVMDAD 264
Cdd:smart00897 143 YVFTNGRVHSGAVVVAFG---GGLRFGTGVTQGWRPIGPPFVVTKAE 186
MCPsignal super family cl28165
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
453-641 2.21e-29

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


The actual alignment was detected with superfamily member smart00283:

Pssm-ID: 332985  Cd Length: 262  Bit Score: 118.54  E-value: 2.21e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    453 NRMVMLNRIKDDIVHRLTEYLSASATLSGKVEGALRQTASINAIVEEIRSVIVASAQSAARATDTT--------ALSQEF 524
Cdd:smart00283   4 EAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMdqirevveEAVSAV 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    525 AGLTQAMNGLRDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQDTKTS-------LTRTHASIGGM 597
Cdd:smart00283  84 EELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESakeieslIKEIQEETNEA 163
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....
gi 27379302    598 ETSLESLGANINDTRGQLIQTQEGYNSIVTQIEEMFKNLQMINT 641
Cdd:smart00283 164 VAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAA 207
FIST_C pfam10442
FIST C domain; The FIST C domain is a novel sensory domain, which is present in signal ...
283-407 2.80e-15

FIST C domain; The FIST C domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


:

Pssm-ID: 313636  Cd Length: 135  Bit Score: 74.65  E-value: 2.80e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302   283 ASVVAKALNTIPA-NLMSMMTKHSFGIEVG-GDLFVRSVAGIDADSGVVSFFCDVNSGDRLELLEATdfVDQTRRDLEAF 360
Cdd:pfam10442   2 LEVYAEYLGGEDDeELPASALLFPLGVVVGgGDYLVRSPLGVDEEDGSLAFAGDVPEGSVVQLMLRD--ADDLIEALERA 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 27379302   361 LR--DKPPAIGAILNDCILRRLNNESQLRNMSGM------WPMPVAGFSTFGELF 407
Cdd:pfam10442  80 AEaaLARPPEGALLFSCAGRGLGLGDRADEELEAvqealgDGVPLAGFYTYGEIG 134
 
Name Accession Description Interval E-value
FIST smart00897
FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal ...
60-264 6.45e-35

FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


Pssm-ID: 214894  Cd Length: 196  Bit Score: 132.44  E-value: 6.45e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302     60 LVLAFISPHCDFARVASSLQ-RLAGSTPVIAMSTAGELCSAgqslykptgsnwssvVVQVLPADLFQSVSIHSVRLHNDD 138
Cdd:smart00897   4 LVLFFSSPAYDAEALLAALReRFPGATPIVGCSTAGEITTG---------------VVQEFEDEPALSVMLFELPLVSFD 68
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    139 IRKGepsrahDARIEAITREVAAIRTPFAIDVRDTIAFALVDGVSAS-ESYFMEAVYRSGKFPCGFVGGSAGGKLDFQHT 217
Cdd:smart00897  69 VFSL------VDPLPDLVAGLLLAALLAAIDPRNTFALLLLDDLSSSnEEELLEGLDEALPEGIPIGGGSAGDNLRFQET 142
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 27379302    218 HLYDGRQVLENHALIVFMklaPGRAYGIFKTQNFKKTGKSFVVMDAD 264
Cdd:smart00897 143 YVFTNGRVHSGAVVVAFG---GGLRFGTGVTQGWRPIGPPFVVTKAE 186
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
453-641 2.21e-29

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 118.54  E-value: 2.21e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    453 NRMVMLNRIKDDIVHRLTEYLSASATLSGKVEGALRQTASINAIVEEIRSVIVASAQSAARATDTT--------ALSQEF 524
Cdd:smart00283   4 EAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMdqirevveEAVSAV 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    525 AGLTQAMNGLRDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQDTKTS-------LTRTHASIGGM 597
Cdd:smart00283  84 EELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESakeieslIKEIQEETNEA 163
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....
gi 27379302    598 ETSLESLGANINDTRGQLIQTQEGYNSIVTQIEEMFKNLQMINT 641
Cdd:smart00283 164 VAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAA 207
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
479-664 1.73e-25

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 105.78  E-value: 1.73e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 479 LSGKVEGALRQTASINAIVEEIRSVIVASAQSAARATDTTALSQEFAG-LTQAMNGLRD-------ILKIIDTIAGQTNL 550
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDeAVSAVEELEEssaeigeIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 551 LALNATIESARAGEAGRGFSVVATEVKKLAQDTKTSlTRTHASIggmetsLESLGANINDTRGQLIQTQEGYNSIVTQIE 630
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEA-AKEIEEL------IEEIQEQTEEAVEAMEETSEEVEEGVELVE 155
                       170       180       190
                ....*....|....*....|....*....|....
gi 27379302 631 EMFKNLQMINTVLSDlesfVRDRNGALTSAMSDI 664
Cdd:cd11386 156 ETGRAFEEIVASVEE----VADGIQEISAATQEQ 185
COG3287 COG3287
Uncharacterized conserved protein, contains FIST_N domain [Function unknown];
39-420 5.91e-25

Uncharacterized conserved protein, contains FIST_N domain [Function unknown];


Pssm-ID: 225825  Cd Length: 379  Bit Score: 107.46  E-value: 5.91e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  39 SDDRLQNISEGDFVVEGARSPLVLAFISP-HCDFARVASSLQRLAGSTPVIAMSTAGELcsagqslyKPTGSNWSSVVVQ 117
Cdd:COG3287  12 GKDAESVIEEMARQLGSDRSDFVLIFFSPeRDEHVQLASALKQAFPGICLIGCSTAGEI--------TPDGFKNGSVLLL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 118 VLPADLFQSVSIHSVRLHNDDIRKGEPsrahdARIEAITREVAAIRTPfaidVRDTIAFALVDGVSASESYFMEA--VYR 195
Cdd:COG3287  84 AFDSSEFAALSTALVDRESPVSRDPIA-----EAIERLIRDKRDRLSP----TRPVLALTFIDGLSTSEEVLLDGavLAA 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 196 SGKFPcgFVGGSAGGKLDFQHTHLYDGRQVLENHALIVFmkLAPGRAYGIFKTQNFKKTGKSFVVMDADPDRrtasgVME 275
Cdd:COG3287 155 LETIP--IFGGSAADDLEFERTYVFDEGEVHEDAAVILL--FGTQLKFGHGFAHGFVPTDKTGVVTKADGDV-----VYE 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 276 --GseiKPFASVVAKALNTIPANLMSMMTKHSFGIEVGGDLF-VRSVAGIDADSGVVSFFCDVNSGDRLELLEATDFVDQ 352
Cdd:COG3287 226 idG---EPAAEEYAEVVGAVEELDPEMFIPNPLGVRDLGPLYyVRAPQFVDEEGGLIFLSAAIPLGVVLRLGETGGIERV 302
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27379302 353 TRRDLEAFLRDKPPAIGAIL-NDCILRRL--NNESQLRNMSGMWPM-PVAGFSTFGELF---GIN--INQTLTAIVF 420
Cdd:COG3287 303 TERALRRAFEDLPKAPALVLvFDCALRRLflDTDKERQPLKEQLPEdPCVGFNTYGEQGpitGENvhHNQTFVGVAF 379
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
458-670 4.39e-24

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 105.07  E-value: 4.39e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 458 LNRIKDDIVHRLTEYLSASATLSGKVEGALRQTASINAIVEEIRSVIVASAQSAARATDTT-----ALSQEFAGLTQAMN 532
Cdd:COG0840 157 LSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMqeiaeELAEVVKKLSESSQ 236
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 533 GLRDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQDTKTSLTRTHASIGGMETSLESLGANINDTR 612
Cdd:COG0840 237 EIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESA 316
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 27379302 613 GQLIQTQEGYNSIVTQIEEMFKNLQMINTVLSDLESFVRDRNGALTSAMSDIETLKRI 670
Cdd:COG0840 317 SEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDV 374
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
517-658 2.51e-20

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 90.97  E-value: 2.51e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302   517 TTALSQEFAGLTQAMNGLR-------DILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQDTKTSLTR 589
Cdd:pfam00015  15 MSQIGQVVDDAVETMEELEtsskkisDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 94
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 27379302   590 THA----SIGGMETSLESL---GANINDTRGQLIQTQEGYNSIVTQIEEMFKNLQMINTVLSDLESFVRDRNGALT 658
Cdd:pfam00015  95 IEAlieeIVKQTNDSTASIqqtRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAVA 170
FIST_C pfam10442
FIST C domain; The FIST C domain is a novel sensory domain, which is present in signal ...
283-407 2.80e-15

FIST C domain; The FIST C domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


Pssm-ID: 313636  Cd Length: 135  Bit Score: 74.65  E-value: 2.80e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302   283 ASVVAKALNTIPA-NLMSMMTKHSFGIEVG-GDLFVRSVAGIDADSGVVSFFCDVNSGDRLELLEATdfVDQTRRDLEAF 360
Cdd:pfam10442   2 LEVYAEYLGGEDDeELPASALLFPLGVVVGgGDYLVRSPLGVDEEDGSLAFAGDVPEGSVVQLMLRD--ADDLIEALERA 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 27379302   361 LR--DKPPAIGAILNDCILRRLNNESQLRNMSGM------WPMPVAGFSTFGELF 407
Cdd:pfam10442  80 AEaaLARPPEGALLFSCAGRGLGLGDRADEELEAvqealgDGVPLAGFYTYGEIG 134
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
469-580 7.15e-15

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 77.80  E-value: 7.15e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  469 LTEYLSASATLSGKVE---GALRQTAsinAIVEEIRSVIVASAQSAARATD------TTALS------------QEFAGL 527
Cdd:PRK09793 277 IAEIVAGNNDLSSRTEqqaASLAQTA---ASMEQLTATVGQNADNARQASElaknaaTTAQAggvqvstmthtmQEIATS 353
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 27379302  528 TQAMNglrDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLA 580
Cdd:PRK09793 354 SQKIG---DIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLA 403
FIST pfam08495
FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal ...
60-264 3.55e-10

FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


Pssm-ID: 312108  Cd Length: 124  Bit Score: 59.13  E-value: 3.55e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    60 LVLAFISPHCDFARVASSLQRLAGSTPVIAMSTAGElcsagqslykptgsnwssvvvqvlpadlfqsvsihsvrlhnddi 139
Cdd:pfam08495   2 LVLVFASPEYDLEALLEALREAFPGAPVIGCSTAGE-------------------------------------------- 37
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302   140 rkgepsrahdarieaitrevaairtpfaidvrdtiafALVDGvsasesyfMEAVYRSGKFPCgfVGGSAGGKLDFQHTHL 219
Cdd:pfam08495  38 -------------------------------------ELLEG--------LDSALGDGGVPI--FGGLAGDGLRFEKTWV 70
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 27379302   220 YDGRQVLENHALIVFMKlAPGRAYGIFKTQNFKKTGKSFVVMDAD 264
Cdd:pfam08495  71 FFNGQVYSDGAVVVALY-GDALPVGTGVSQGWRPIGPPFVVTKAD 114
 
Name Accession Description Interval E-value
FIST smart00897
FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal ...
60-264 6.45e-35

FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


Pssm-ID: 214894  Cd Length: 196  Bit Score: 132.44  E-value: 6.45e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302     60 LVLAFISPHCDFARVASSLQ-RLAGSTPVIAMSTAGELCSAgqslykptgsnwssvVVQVLPADLFQSVSIHSVRLHNDD 138
Cdd:smart00897   4 LVLFFSSPAYDAEALLAALReRFPGATPIVGCSTAGEITTG---------------VVQEFEDEPALSVMLFELPLVSFD 68
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    139 IRKGepsrahDARIEAITREVAAIRTPFAIDVRDTIAFALVDGVSAS-ESYFMEAVYRSGKFPCGFVGGSAGGKLDFQHT 217
Cdd:smart00897  69 VFSL------VDPLPDLVAGLLLAALLAAIDPRNTFALLLLDDLSSSnEEELLEGLDEALPEGIPIGGGSAGDNLRFQET 142
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 27379302    218 HLYDGRQVLENHALIVFMklaPGRAYGIFKTQNFKKTGKSFVVMDAD 264
Cdd:smart00897 143 YVFTNGRVHSGAVVVAFG---GGLRFGTGVTQGWRPIGPPFVVTKAE 186
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
453-641 2.21e-29

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 118.54  E-value: 2.21e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    453 NRMVMLNRIKDDIVHRLTEYLSASATLSGKVEGALRQTASINAIVEEIRSVIVASAQSAARATDTT--------ALSQEF 524
Cdd:smart00283   4 EAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMdqirevveEAVSAV 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    525 AGLTQAMNGLRDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQDTKTS-------LTRTHASIGGM 597
Cdd:smart00283  84 EELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESakeieslIKEIQEETNEA 163
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....
gi 27379302    598 ETSLESLGANINDTRGQLIQTQEGYNSIVTQIEEMFKNLQMINT 641
Cdd:smart00283 164 VAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAA 207
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
479-664 1.73e-25

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 105.78  E-value: 1.73e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 479 LSGKVEGALRQTASINAIVEEIRSVIVASAQSAARATDTTALSQEFAG-LTQAMNGLRD-------ILKIIDTIAGQTNL 550
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDeAVSAVEELEEssaeigeIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 551 LALNATIESARAGEAGRGFSVVATEVKKLAQDTKTSlTRTHASIggmetsLESLGANINDTRGQLIQTQEGYNSIVTQIE 630
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEA-AKEIEEL------IEEIQEQTEEAVEAMEETSEEVEEGVELVE 155
                       170       180       190
                ....*....|....*....|....*....|....
gi 27379302 631 EMFKNLQMINTVLSDlesfVRDRNGALTSAMSDI 664
Cdd:cd11386 156 ETGRAFEEIVASVEE----VADGIQEISAATQEQ 185
COG3287 COG3287
Uncharacterized conserved protein, contains FIST_N domain [Function unknown];
39-420 5.91e-25

Uncharacterized conserved protein, contains FIST_N domain [Function unknown];


Pssm-ID: 225825  Cd Length: 379  Bit Score: 107.46  E-value: 5.91e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  39 SDDRLQNISEGDFVVEGARSPLVLAFISP-HCDFARVASSLQRLAGSTPVIAMSTAGELcsagqslyKPTGSNWSSVVVQ 117
Cdd:COG3287  12 GKDAESVIEEMARQLGSDRSDFVLIFFSPeRDEHVQLASALKQAFPGICLIGCSTAGEI--------TPDGFKNGSVLLL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 118 VLPADLFQSVSIHSVRLHNDDIRKGEPsrahdARIEAITREVAAIRTPfaidVRDTIAFALVDGVSASESYFMEA--VYR 195
Cdd:COG3287  84 AFDSSEFAALSTALVDRESPVSRDPIA-----EAIERLIRDKRDRLSP----TRPVLALTFIDGLSTSEEVLLDGavLAA 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 196 SGKFPcgFVGGSAGGKLDFQHTHLYDGRQVLENHALIVFmkLAPGRAYGIFKTQNFKKTGKSFVVMDADPDRrtasgVME 275
Cdd:COG3287 155 LETIP--IFGGSAADDLEFERTYVFDEGEVHEDAAVILL--FGTQLKFGHGFAHGFVPTDKTGVVTKADGDV-----VYE 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 276 --GseiKPFASVVAKALNTIPANLMSMMTKHSFGIEVGGDLF-VRSVAGIDADSGVVSFFCDVNSGDRLELLEATDFVDQ 352
Cdd:COG3287 226 idG---EPAAEEYAEVVGAVEELDPEMFIPNPLGVRDLGPLYyVRAPQFVDEEGGLIFLSAAIPLGVVLRLGETGGIERV 302
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27379302 353 TRRDLEAFLRDKPPAIGAIL-NDCILRRL--NNESQLRNMSGMWPM-PVAGFSTFGELF---GIN--INQTLTAIVF 420
Cdd:COG3287 303 TERALRRAFEDLPKAPALVLvFDCALRRLflDTDKERQPLKEQLPEdPCVGFNTYGEQGpitGENvhHNQTFVGVAF 379
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
458-670 4.39e-24

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 105.07  E-value: 4.39e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 458 LNRIKDDIVHRLTEYLSASATLSGKVEGALRQTASINAIVEEIRSVIVASAQSAARATDTT-----ALSQEFAGLTQAMN 532
Cdd:COG0840 157 LSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMqeiaeELAEVVKKLSESSQ 236
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302 533 GLRDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQDTKTSLTRTHASIGGMETSLESLGANINDTR 612
Cdd:COG0840 237 EIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESA 316
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 27379302 613 GQLIQTQEGYNSIVTQIEEMFKNLQMINTVLSDLESFVRDRNGALTSAMSDIETLKRI 670
Cdd:COG0840 317 SEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDV 374
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
517-658 2.51e-20

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 90.97  E-value: 2.51e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302   517 TTALSQEFAGLTQAMNGLR-------DILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQDTKTSLTR 589
Cdd:pfam00015  15 MSQIGQVVDDAVETMEELEtsskkisDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 94
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 27379302   590 THA----SIGGMETSLESL---GANINDTRGQLIQTQEGYNSIVTQIEEMFKNLQMINTVLSDLESFVRDRNGALT 658
Cdd:pfam00015  95 IEAlieeIVKQTNDSTASIqqtRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAVA 170
FIST_C pfam10442
FIST C domain; The FIST C domain is a novel sensory domain, which is present in signal ...
283-407 2.80e-15

FIST C domain; The FIST C domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


Pssm-ID: 313636  Cd Length: 135  Bit Score: 74.65  E-value: 2.80e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302   283 ASVVAKALNTIPA-NLMSMMTKHSFGIEVG-GDLFVRSVAGIDADSGVVSFFCDVNSGDRLELLEATdfVDQTRRDLEAF 360
Cdd:pfam10442   2 LEVYAEYLGGEDDeELPASALLFPLGVVVGgGDYLVRSPLGVDEEDGSLAFAGDVPEGSVVQLMLRD--ADDLIEALERA 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 27379302   361 LR--DKPPAIGAILNDCILRRLNNESQLRNMSGM------WPMPVAGFSTFGELF 407
Cdd:pfam10442  80 AEaaLARPPEGALLFSCAGRGLGLGDRADEELEAvqealgDGVPLAGFYTYGEIG 134
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
469-580 7.15e-15

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 77.80  E-value: 7.15e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  469 LTEYLSASATLSGKVE---GALRQTAsinAIVEEIRSVIVASAQSAARATD------TTALS------------QEFAGL 527
Cdd:PRK09793 277 IAEIVAGNNDLSSRTEqqaASLAQTA---ASMEQLTATVGQNADNARQASElaknaaTTAQAggvqvstmthtmQEIATS 353
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 27379302  528 TQAMNglrDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLA 580
Cdd:PRK09793 354 SQKIG---DIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLA 403
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
441-657 7.43e-15

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 77.74  E-value: 7.43e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  441 AHFVEYFTRTHLNRMVMLNRIKDDIVHRLTEYLSASATLSGKVE---GALRQTAsinAIVEEIRSVIVASAQSAARATDT 517
Cdd:PRK15048 251 AQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEqqaSALEETA---ASMEQLTATVKQNADNARQASQL 327
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  518 TALSQEFA--------GLTQAMN-------GLRDILKIIDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQD 582
Cdd:PRK15048 328 AQSASDTAqhggkvvdGVVKTMHeiadsskKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASR 407
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  583 TKTSLTRTHA----SIGGMETS---LESLGANINDTRGQLIQTQEGYNSIVTQIEEMFKNLQMINTVLSDLESfVRDRNG 655
Cdd:PRK15048 408 SAQAAKEIKAliedSVSRVDTGsvlVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDR-VTQQNA 486

                 ..
gi 27379302  656 AL 657
Cdd:PRK15048 487 SL 488
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
479-581 4.65e-14

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 74.99  E-value: 4.65e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  479 LSGKVEgalRQTASIN---AIVEEIRSVIVASAQSAARATDTTALSQEFA--------GLTQAM-------NGLRDILKI 540
Cdd:PRK15041 291 LSSRTE---QQAASLEetaASMEQLTATVKQNAENARQASHLALSASETAqrggkvvdNVVQTMrdistssQKIADIISV 367
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 27379302  541 IDTIAGQTNLLALNATIESARAGEAGRGFSVVATEVKKLAQ 581
Cdd:PRK15041 368 IDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQ 408
FIST pfam08495
FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal ...
60-264 3.55e-10

FIST N domain; The FIST N domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids.


Pssm-ID: 312108  Cd Length: 124  Bit Score: 59.13  E-value: 3.55e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302    60 LVLAFISPHCDFARVASSLQRLAGSTPVIAMSTAGElcsagqslykptgsnwssvvvqvlpadlfqsvsihsvrlhnddi 139
Cdd:pfam08495   2 LVLVFASPEYDLEALLEALREAFPGAPVIGCSTAGE-------------------------------------------- 37
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302   140 rkgepsrahdarieaitrevaairtpfaidvrdtiafALVDGvsasesyfMEAVYRSGKFPCgfVGGSAGGKLDFQHTHL 219
Cdd:pfam08495  38 -------------------------------------ELLEG--------LDSALGDGGVPI--FGGLAGDGLRFEKTWV 70
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 27379302   220 YDGRQVLENHALIVFMKlAPGRAYGIFKTQNFKKTGKSFVVMDAD 264
Cdd:pfam08495  71 FFNGQVYSDGAVVVALY-GDALPVGTGVSQGWRPIGPPFVVTKAD 114
PRK12802 PRK12802
flagellin; Provisional
484-671 7.55e-03

flagellin; Provisional


Pssm-ID: 139237  Cd Length: 282  Bit Score: 38.71  E-value: 7.55e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  484 EGALRQTASInaiVEEIRSVIVASAQSAARATDTTALSQEFAGLtqamnglrdiLKIIDTIAGQTNLLA---LNATIES- 559
Cdd:PRK12802  79 EGALQESTNI---LQRMRELAVQSRNDSNDSTDRAALNKEFTTM----------LDEITRIATSTTLNGknlLDGSAGTm 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27379302  560 -----ARAGEAGR-------GFSVVATEVKKLAQDTKTSLTRTHASIGGMETSLESLGANINDTRGQLIQTQEGYNSIVT 627
Cdd:PRK12802 146 tfqvgANTGQSNQitfglsaSFDATGLGVGSGTLITGADSAAAETNAQAAITAIDAALQTINTTRADLGAAQNRLQSTIS 225
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 27379302  628 qieemfkNLQMINTVLSDLESFVRDRN-GALTSAMSDIETLKRIG 671
Cdd:PRK12802 226 -------NLQNINENASAARGRVQDTDfAAETAQLTKQQTLQQAS 263
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH