NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|26051250|ref|NP_742086|]
View 

TNFSF12-TNFSF13 protein [Homo sapiens]

Protein Classification

TNF domain-containing protein (domain architecture ID 10212252)

TNF domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TNF cd00184
Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT ...
197-328 1.12e-26

Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.


:

Pssm-ID: 238108  Cd Length: 137  Bit Score: 103.96  E-value: 1.12e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26051250 197 VLHLVPINATSKDdsdvTEVMWQPALRRG---RGLQAQGYGVRIQDAGVYLLYSQVLFQD---VTFTMGQVVSREGQGRQ 270
Cdd:cd00184   2 AAHLIGTNSSSGG----TGLSWESDDGRAflsGGLELQNGELVVPQDGLYYIYSQVYFRGqccSTLSVSHVLQLRTDSYP 77
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 26051250 271 E--TLFRCIRSMPSHP-DRAYNSCYSAGVFHLHQGDILSVIIPRaRAKLNLSPHGTFLGFV 328
Cdd:cd00184  78 EpiLLLKGIRSVCSSVsEGWYNSVYLGGLFQLRAGDRLSVNVSA-PALLDLSQGTTFFGAF 137
TNF super family cl00147
Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT ...
131-166 9.08e-08

Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.


The actual alignment was detected with superfamily member smart00207:

Pssm-ID: 320782  Cd Length: 125  Bit Score: 50.42  E-value: 9.08e-08
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 26051250    131 SGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQ 166
Cdd:smart00207   1 LSWESDRGLASLLSGMELQNGELVVPRDGLYYIYSQ 36
 
Name Accession Description Interval E-value
TNF cd00184
Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT ...
197-328 1.12e-26

Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.


Pssm-ID: 238108  Cd Length: 137  Bit Score: 103.96  E-value: 1.12e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26051250 197 VLHLVPINATSKDdsdvTEVMWQPALRRG---RGLQAQGYGVRIQDAGVYLLYSQVLFQD---VTFTMGQVVSREGQGRQ 270
Cdd:cd00184   2 AAHLIGTNSSSGG----TGLSWESDDGRAflsGGLELQNGELVVPQDGLYYIYSQVYFRGqccSTLSVSHVLQLRTDSYP 77
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 26051250 271 E--TLFRCIRSMPSHP-DRAYNSCYSAGVFHLHQGDILSVIIPRaRAKLNLSPHGTFLGFV 328
Cdd:cd00184  78 EpiLLLKGIRSVCSSVsEGWYNSVYLGGLFQLRAGDRLSVNVSA-PALLDLSQGTTFFGAF 137
TNF pfam00229
TNF(tumor Necrosis Factor) family;
236-330 9.49e-10

TNF(tumor Necrosis Factor) family;


Pssm-ID: 306692  Cd Length: 127  Bit Score: 56.15  E-value: 9.49e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26051250   236 RIQDAGVYLLYSQVLFQDVTFTMGQV-----VSREGQGRQE--TLFRCIRSMPS--HPDRAYNSCYSAGVFHLHQGDILS 306
Cdd:pfam00229  24 VVPQAGLYYVYSQVYFRGEGCSSSSVplthyLYKKSSSYPGpvLLLKGAESPCSseNPEYWLQSIYLGGLFELRAGDRLS 103
                          90       100
                  ....*....|....*....|....*
gi 26051250   307 VIIPrARAKLNLSPHG-TFLGFVKL 330
Cdd:pfam00229 104 VNVS-NPSLVDLSAPGkTFFGAFLL 127
TNF smart00207
Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric ...
131-166 9.08e-08

Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75 TNF receptor.


Pssm-ID: 214557  Cd Length: 125  Bit Score: 50.42  E-value: 9.08e-08
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 26051250    131 SGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQ 166
Cdd:smart00207   1 LSWESDRGLASLLSGMELQNGELVVPRDGLYYIYSQ 36
TNF smart00207
Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric ...
226-307 1.65e-03

Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75 TNF receptor.


Pssm-ID: 214557  Cd Length: 125  Bit Score: 37.71  E-value: 1.65e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26051250    226 RGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQET--------LFRCIRSMPSHPDRAYNSCYSAGVF 297
Cdd:smart00207  14 SGMELQNGELVVPRDGLYYIYSQVYFRGQGCNGKSVELSLSLHLRKPsyplplllLEAARSSCWSASSAWKDSVYLGGLF 93
                           90
                   ....*....|
gi 26051250    298 HLHQGDILSV 307
Cdd:smart00207  94 PLTAGDRLSV 103
 
Name Accession Description Interval E-value
TNF cd00184
Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT ...
197-328 1.12e-26

Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.


Pssm-ID: 238108  Cd Length: 137  Bit Score: 103.96  E-value: 1.12e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26051250 197 VLHLVPINATSKDdsdvTEVMWQPALRRG---RGLQAQGYGVRIQDAGVYLLYSQVLFQD---VTFTMGQVVSREGQGRQ 270
Cdd:cd00184   2 AAHLIGTNSSSGG----TGLSWESDDGRAflsGGLELQNGELVVPQDGLYYIYSQVYFRGqccSTLSVSHVLQLRTDSYP 77
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 26051250 271 E--TLFRCIRSMPSHP-DRAYNSCYSAGVFHLHQGDILSVIIPRaRAKLNLSPHGTFLGFV 328
Cdd:cd00184  78 EpiLLLKGIRSVCSSVsEGWYNSVYLGGLFQLRAGDRLSVNVSA-PALLDLSQGTTFFGAF 137
TNF pfam00229
TNF(tumor Necrosis Factor) family;
236-330 9.49e-10

TNF(tumor Necrosis Factor) family;


Pssm-ID: 306692  Cd Length: 127  Bit Score: 56.15  E-value: 9.49e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26051250   236 RIQDAGVYLLYSQVLFQDVTFTMGQV-----VSREGQGRQE--TLFRCIRSMPS--HPDRAYNSCYSAGVFHLHQGDILS 306
Cdd:pfam00229  24 VVPQAGLYYVYSQVYFRGEGCSSSSVplthyLYKKSSSYPGpvLLLKGAESPCSseNPEYWLQSIYLGGLFELRAGDRLS 103
                          90       100
                  ....*....|....*....|....*
gi 26051250   307 VIIPrARAKLNLSPHG-TFLGFVKL 330
Cdd:pfam00229 104 VNVS-NPSLVDLSAPGkTFFGAFLL 127
TNF smart00207
Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric ...
131-166 9.08e-08

Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75 TNF receptor.


Pssm-ID: 214557  Cd Length: 125  Bit Score: 50.42  E-value: 9.08e-08
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 26051250    131 SGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQ 166
Cdd:smart00207   1 LSWESDRGLASLLSGMELQNGELVVPRDGLYYIYSQ 36
TNF smart00207
Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric ...
226-307 1.65e-03

Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75 TNF receptor.


Pssm-ID: 214557  Cd Length: 125  Bit Score: 37.71  E-value: 1.65e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26051250    226 RGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQET--------LFRCIRSMPSHPDRAYNSCYSAGVF 297
Cdd:smart00207  14 SGMELQNGELVVPRDGLYYIYSQVYFRGQGCNGKSVELSLSLHLRKPsyplplllLEAARSSCWSASSAWKDSVYLGGLF 93
                           90
                   ....*....|
gi 26051250    298 HLHQGDILSV 307
Cdd:smart00207  94 PLTAGDRLSV 103
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH