NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|256985106|ref|NP_083373|]
View 

probable cation-transporting ATPase 13A2 isoform 1 [Mus musculus]

Protein Classification

P5-ATPase and COG4087 domain-containing protein (domain architecture ID 11193531)

protein containing domains P5-ATPase, E1-E2_ATPase, Cation_ATPase, and COG4087

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
E1-E2_ATPase super family cl02811
E1-E2 ATPase;
258-493 1.32e-32

E1-E2 ATPase;


The actual alignment was detected with superfamily member pfam00122:

Pssm-ID: 278548  Cd Length: 221  Bit Score: 127.68  E-value: 1.32e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   258 IFLISAISICLALYKTRKQSLTLRDMVKLSVR-VQVCRPGGEEEwVDSSELVPGDcLVLPQEGGVMPCDAALVAGECVVN 336
Cdd:pfam00122    3 ILLLVLLNALLEFYQEARARKALKALKSLLPPtATVLRDGGEVE-VPADELVPGD-IVLLKPGERIPADGRIVEGSLSVD 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   337 ESSLTGESTPVLKtalpegpkpycpetHRRHTLFCGTLILQARAyvgprvLAVVTRTGFCTAKGGLVSSILH----PRPI 412
Cdd:pfam00122   81 ESALTGESLPVEK--------------KKGDMVFSGTVVVSGSA------KAVVTATGEDTTLGKIARLVEEakskKTPL 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   413 SFKFYKHSMKFVAALSVLALLgtvySIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIH 492
Cdd:pfam00122  141 QRLLDKLAKYFTPVVLLLALA----VFLLTLLLGGDLAEALLRALAVLVAACPCALPLATPLALAVGARRLAKKGILVKR 216

                   .
gi 256985106   493 P 493
Cdd:pfam00122  217 L 217
P5-ATPase pfam12409
P5-type ATPase cation transporter; This domain family is found in eukaryotes, and is typically ...
35-161 1.65e-22

P5-type ATPase cation transporter; This domain family is found in eukaryotes, and is typically between 110 and 126 amino acids in length. The family is found in association with pfam00122, pfam00702. P-type ATPases comprise a large superfamily of proteins, present in both prokaryotes and eukaryotes, that transport inorganic cations and other substrates across cell membranes.


:

Pssm-ID: 289194  Cd Length: 118  Bit Score: 95.26  E-value: 1.65e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106    35 VRLSGYCGSPWRAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIeikdkEGSSRQLFTVQVQTEAVVQ 114
Cdd:pfam12409    5 IEIAGYRTSRWRLALYYLLCVLTLGLLYLLFRWLPRWRVRLTGKPCPLAEADWVVI-----EDQWGELSIKKVKSEPYGR 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 256985106   115 G-SLELPPqaqaedgrsqaAVGVTPEGTWQDTSELHrqeEAKQVLRYY 161
Cdd:pfam12409   80 PlSTVFPL-----------EDGESDSVASHDDEEND---PILPKLRYF 113
COG4087 COG4087
Soluble P-type ATPase [General function prediction only];
839-888 1.82e-05

Soluble P-type ATPase [General function prediction only];


:

Pssm-ID: 226572  Cd Length: 152  Bit Score: 44.86  E-value: 1.82e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 256985106  839 VFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAE 888
Cdd:COG4087    73 VFAGADPEMKAKIIRELKKRYEKVVMVGNGANDILALREADLGICTIQQE 122
Cation_ATPase super family cl16182
Cation transport ATPase (P-type); This domain is found in cation transport ATPases, including ...
621-658 3.45e-04

Cation transport ATPase (P-type); This domain is found in cation transport ATPases, including phospholipid-transporting ATPases, calcium-transporting ATPases, and sodium-potassium ATPases.


The actual alignment was detected with superfamily member pfam13246:

Pssm-ID: 289987  Cd Length: 93  Bit Score: 40.32  E-value: 3.45e-04
                           10        20        30
                   ....*....|....*....|....*....|....*...
gi 256985106   621 FPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCS 658
Cdd:pfam13246   54 IPFNSDRKRMSVVHKLEDDGYRLLFVKGAPERILERCT 91
Cation_ATPase_N super family cl02930
Cation transporter/ATPase, N-terminus; Members of this families are involved in Na+/K+, H+/K+, ...
188-260 8.06e-04

Cation transporter/ATPase, N-terminus; Members of this families are involved in Na+/K+, H+/K+, Ca++ and Mg++ transport.


The actual alignment was detected with superfamily member smart00831:

Pssm-ID: 295564  Cd Length: 75  Bit Score: 39.10  E-value: 8.06e-04
                            10        20        30        40        50        60        70
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 256985106    188 TCDDVHCS-SSGLSLQDQATRKTIYGPNVISIPVK-SYLQLLADEALNPyygfqaFSIALWLADhyywyALCIFL 260
Cdd:smart00831   12 VLERLQTDlEKGLSSEEAARRLERYGPNELPPPKKtSPLLRFLRQFHNP------LIYILLAAA-----VLSALL 75
P-ATPase-V TIGR01657
P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade ...
35-1112 0e+00

P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in.


:

Pssm-ID: 273738 [Multi-domain]  Cd Length: 1054  Bit Score: 1337.01  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106    35 VRLSGYCGSPWRAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIEIKdkegssrqlftvqvQTEAVVQ 114
Cdd:TIGR01657    4 IGISAYKISPFKLIIYLVTLILTFGLVLLLLTWLPEWKVKLRYVPVSNEDAETVVIVDP--------------TPNSGSD 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   115 GSLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVlryyvlqgqrYVWMETQQAFCQVSlldHGRTCDDVHc 194
Cdd:TIGR01657   70 YIVELSNKSLSNDLQTENAVEGGEEPIYFDFRKQRFSYHEKEL----------KIFSPLPYLFKEKS---FGVYSTCAG- 135
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   195 SSSGLSLQDQATRKTIYGPNVISIPVKSYLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLALYKTR 274
Cdd:TIGR01657  136 HSNGLTTGDIAQRKAKYGKNEIEIPVPSFLELLKEEVLHPFYVFQVFSVILWLLDEYYYYSLCIVFMSSTSISLSVYQIR 215
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   275 KQSLTLRDMVKLSVRVQVCRPGgEEEWVDSSELVPGDCLVLP-QEGGVMPCDAALVAGECVVNESSLTGESTPVLKTALP 353
Cdd:TIGR01657  216 KQMQRLRDMVHKPQSVIVIRNG-KWVTIASDELVPGDIVSIPrPEEKTMPCDSVLLSGSCIVNESMLTGESVPVLKFPIP 294
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   354 EG----PKPYCPETHRRHTLFCGTLILQARAYVGPR-VLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMKFVAALS 428
Cdd:TIGR01657  295 DNgdddEDLFLYETSKKHVLFGGTKILQIRPYPGDTgCLAIVVRTGFSTSKGQLVRSILYPKPRVFKFYKDSFKFILFLA 374
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   429 VLALLGTVYSIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFD 508
Cdd:TIGR01657  375 VLALIGFIYTIIELIKDGRPLGKIILRSLDIITIVVPPALPAELSIGINNSLARLKKKGIFCTSPFRINFAGKIDVCCFD 454
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   509 KTGTLTEDGLDVMGVVPLKG-QVLLPLVPEPCHLPLGPLLRALATCHALSQLHDTPVGDPMDLKMVESTGWVLEEgpAAG 587
Cdd:TIGR01657  455 KTGTLTEDGLDLRGVQGLSGnQEFLKIVTEDSSLKPSITHKALATCHSLTKLEGKLVGDPLDKKMFEATGWTLEE--DDE 532
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   588 SAPGSQVLVVMRpppggprqQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCSPETVPSDFS 667
Cdd:TIGR01657  533 SAEPTSILAVVR--------TDDPPQELSIIRRFQFSSALQRMSVIVSTNDERSPDAFVKGAPETIQSLCSPETVPSDYQ 604
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   668 QVLQSYTAAGYRVVALAGKPLPiAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNL 747
Cdd:TIGR01657  605 EVLKSYTREGYRVLALAYKELP-KLTLQKAQDLSRDAVESNLTFLGFIVFENPLKPDTKEVIKELKRASIRTVMITGDNP 683
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   748 QTAVTVARACGMVGAQEHLAVIHATHPEQGQPAALEFLPTESSAVMNGAKATGYP----TVPEPQSC--HLALSGSTFAV 821
Cdd:TIGR01657  684 LTAVHVARECGIVNPSNTLILAEAEPPESGKPNQIKFEVIDSIPFASTQVEIPYPlgqdSVEDLLASryHLAMSGKAFAV 763
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   822 LRKHFPKLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMAS 901
Cdd:TIGR01657  764 LQAHSPELLLRLLSHTTVFARMAPDQKETLVELLQKLDYTVGMCGDGANDCGALKQADVGISLSEAEASVAAPFTSKLAS 843
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   902 IECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTLVRARP 981
Cdd:TIGR01657  844 ISCVPNVIREGRCALVTSFQMFKYMALYSLIQFYSVSILYLIGSNLGDGQFLTIDLLLIFPVALLMSRNKPLKKLSKERP 923
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   982 PGALLSVPVLGSLLLQVALVAGIQLGGYFLVIAQPWFVPLNRTVPAPDNLPNYENTVVFSLSGFQYLILAAAVSKGAPFR 1061
Cdd:TIGR01657  924 PSNLFSVYILTSVLIQFVLHILSQVYLVFELHAQPWYKPENPVDLEKENFPNLLNTVLFFVSSFQYLITAIVNSKGPPFR 1003
                         1050      1060      1070      1080      1090
                   ....*....|....*....|....*....|....*....|....*....|.
gi 256985106  1062 QPLYTNVPFLVALALLGSVLVGLILVPGLLQGPLGLRNIVDSSFKLLLLGL 1112
Cdd:TIGR01657 1004 EPIYKNKPFVYLLITGLGLLLVLLLDPHPLLGKILQIVPLPQEFRSKLLVW 1054
 
Name Accession Description Interval E-value
E1-E2_ATPase pfam00122
E1-E2 ATPase;
258-493 1.32e-32

E1-E2 ATPase;


Pssm-ID: 278548  Cd Length: 221  Bit Score: 127.68  E-value: 1.32e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   258 IFLISAISICLALYKTRKQSLTLRDMVKLSVR-VQVCRPGGEEEwVDSSELVPGDcLVLPQEGGVMPCDAALVAGECVVN 336
Cdd:pfam00122    3 ILLLVLLNALLEFYQEARARKALKALKSLLPPtATVLRDGGEVE-VPADELVPGD-IVLLKPGERIPADGRIVEGSLSVD 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   337 ESSLTGESTPVLKtalpegpkpycpetHRRHTLFCGTLILQARAyvgprvLAVVTRTGFCTAKGGLVSSILH----PRPI 412
Cdd:pfam00122   81 ESALTGESLPVEK--------------KKGDMVFSGTVVVSGSA------KAVVTATGEDTTLGKIARLVEEakskKTPL 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   413 SFKFYKHSMKFVAALSVLALLgtvySIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIH 492
Cdd:pfam00122  141 QRLLDKLAKYFTPVVLLLALA----VFLLTLLLGGDLAEALLRALAVLVAACPCALPLATPLALAVGARRLAKKGILVKR 216

                   .
gi 256985106   493 P 493
Cdd:pfam00122  217 L 217
P5-ATPase pfam12409
P5-type ATPase cation transporter; This domain family is found in eukaryotes, and is typically ...
35-161 1.65e-22

P5-type ATPase cation transporter; This domain family is found in eukaryotes, and is typically between 110 and 126 amino acids in length. The family is found in association with pfam00122, pfam00702. P-type ATPases comprise a large superfamily of proteins, present in both prokaryotes and eukaryotes, that transport inorganic cations and other substrates across cell membranes.


Pssm-ID: 289194  Cd Length: 118  Bit Score: 95.26  E-value: 1.65e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106    35 VRLSGYCGSPWRAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIeikdkEGSSRQLFTVQVQTEAVVQ 114
Cdd:pfam12409    5 IEIAGYRTSRWRLALYYLLCVLTLGLLYLLFRWLPRWRVRLTGKPCPLAEADWVVI-----EDQWGELSIKKVKSEPYGR 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 256985106   115 G-SLELPPqaqaedgrsqaAVGVTPEGTWQDTSELHrqeEAKQVLRYY 161
Cdd:pfam12409   80 PlSTVFPL-----------EDGESDSVASHDDEEND---PILPKLRYF 113
COG4087 COG4087
Soluble P-type ATPase [General function prediction only];
839-888 1.82e-05

Soluble P-type ATPase [General function prediction only];


Pssm-ID: 226572  Cd Length: 152  Bit Score: 44.86  E-value: 1.82e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 256985106  839 VFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAE 888
Cdd:COG4087    73 VFAGADPEMKAKIIRELKKRYEKVVMVGNGANDILALREADLGICTIQQE 122
Cation_ATPase pfam13246
Cation transport ATPase (P-type); This domain is found in cation transport ATPases, including ...
621-658 3.45e-04

Cation transport ATPase (P-type); This domain is found in cation transport ATPases, including phospholipid-transporting ATPases, calcium-transporting ATPases, and sodium-potassium ATPases.


Pssm-ID: 289987  Cd Length: 93  Bit Score: 40.32  E-value: 3.45e-04
                           10        20        30
                   ....*....|....*....|....*....|....*...
gi 256985106   621 FPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCS 658
Cdd:pfam13246   54 IPFNSDRKRMSVVHKLEDDGYRLLFVKGAPERILERCT 91
Cation_ATPase_N smart00831
Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region ...
188-260 8.06e-04

Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases.


Pssm-ID: 214842  Cd Length: 75  Bit Score: 39.10  E-value: 8.06e-04
                            10        20        30        40        50        60        70
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 256985106    188 TCDDVHCS-SSGLSLQDQATRKTIYGPNVISIPVK-SYLQLLADEALNPyygfqaFSIALWLADhyywyALCIFL 260
Cdd:smart00831   12 VLERLQTDlEKGLSSEEAARRLERYGPNELPPPKKtSPLLRFLRQFHNP------LIYILLAAA-----VLSALL 75
Cation_ATPase_N pfam00690
Cation transporter/ATPase, N-terminus; Members of this families are involved in Na+/K+, H+/K+, ...
194-248 9.00e-03

Cation transporter/ATPase, N-terminus; Members of this families are involved in Na+/K+, H+/K+, Ca++ and Mg++ transport.


Pssm-ID: 279080  Cd Length: 69  Bit Score: 35.97  E-value: 9.00e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 256985106   194 CSSSGLSLQDQATRKTIYGPNVIS-IPVKSYLQLLADEALNPyygfqaFSIALWLA 248
Cdd:pfam00690   16 DSEKGLTEEEAEERLEKYGPNELPeKKKKSLWLIFLRQFKNP------LIIILLVA 65
P-ATPase-V TIGR01657
P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade ...
35-1112 0e+00

P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in.


Pssm-ID: 273738 [Multi-domain]  Cd Length: 1054  Bit Score: 1337.01  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106    35 VRLSGYCGSPWRAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIEIKdkegssrqlftvqvQTEAVVQ 114
Cdd:TIGR01657    4 IGISAYKISPFKLIIYLVTLILTFGLVLLLLTWLPEWKVKLRYVPVSNEDAETVVIVDP--------------TPNSGSD 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   115 GSLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVlryyvlqgqrYVWMETQQAFCQVSlldHGRTCDDVHc 194
Cdd:TIGR01657   70 YIVELSNKSLSNDLQTENAVEGGEEPIYFDFRKQRFSYHEKEL----------KIFSPLPYLFKEKS---FGVYSTCAG- 135
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   195 SSSGLSLQDQATRKTIYGPNVISIPVKSYLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLALYKTR 274
Cdd:TIGR01657  136 HSNGLTTGDIAQRKAKYGKNEIEIPVPSFLELLKEEVLHPFYVFQVFSVILWLLDEYYYYSLCIVFMSSTSISLSVYQIR 215
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   275 KQSLTLRDMVKLSVRVQVCRPGgEEEWVDSSELVPGDCLVLP-QEGGVMPCDAALVAGECVVNESSLTGESTPVLKTALP 353
Cdd:TIGR01657  216 KQMQRLRDMVHKPQSVIVIRNG-KWVTIASDELVPGDIVSIPrPEEKTMPCDSVLLSGSCIVNESMLTGESVPVLKFPIP 294
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   354 EG----PKPYCPETHRRHTLFCGTLILQARAYVGPR-VLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMKFVAALS 428
Cdd:TIGR01657  295 DNgdddEDLFLYETSKKHVLFGGTKILQIRPYPGDTgCLAIVVRTGFSTSKGQLVRSILYPKPRVFKFYKDSFKFILFLA 374
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   429 VLALLGTVYSIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFD 508
Cdd:TIGR01657  375 VLALIGFIYTIIELIKDGRPLGKIILRSLDIITIVVPPALPAELSIGINNSLARLKKKGIFCTSPFRINFAGKIDVCCFD 454
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   509 KTGTLTEDGLDVMGVVPLKG-QVLLPLVPEPCHLPLGPLLRALATCHALSQLHDTPVGDPMDLKMVESTGWVLEEgpAAG 587
Cdd:TIGR01657  455 KTGTLTEDGLDLRGVQGLSGnQEFLKIVTEDSSLKPSITHKALATCHSLTKLEGKLVGDPLDKKMFEATGWTLEE--DDE 532
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   588 SAPGSQVLVVMRpppggprqQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCSPETVPSDFS 667
Cdd:TIGR01657  533 SAEPTSILAVVR--------TDDPPQELSIIRRFQFSSALQRMSVIVSTNDERSPDAFVKGAPETIQSLCSPETVPSDYQ 604
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   668 QVLQSYTAAGYRVVALAGKPLPiAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNL 747
Cdd:TIGR01657  605 EVLKSYTREGYRVLALAYKELP-KLTLQKAQDLSRDAVESNLTFLGFIVFENPLKPDTKEVIKELKRASIRTVMITGDNP 683
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   748 QTAVTVARACGMVGAQEHLAVIHATHPEQGQPAALEFLPTESSAVMNGAKATGYP----TVPEPQSC--HLALSGSTFAV 821
Cdd:TIGR01657  684 LTAVHVARECGIVNPSNTLILAEAEPPESGKPNQIKFEVIDSIPFASTQVEIPYPlgqdSVEDLLASryHLAMSGKAFAV 763
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   822 LRKHFPKLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMAS 901
Cdd:TIGR01657  764 LQAHSPELLLRLLSHTTVFARMAPDQKETLVELLQKLDYTVGMCGDGANDCGALKQADVGISLSEAEASVAAPFTSKLAS 843
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   902 IECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTLVRARP 981
Cdd:TIGR01657  844 ISCVPNVIREGRCALVTSFQMFKYMALYSLIQFYSVSILYLIGSNLGDGQFLTIDLLLIFPVALLMSRNKPLKKLSKERP 923
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   982 PGALLSVPVLGSLLLQVALVAGIQLGGYFLVIAQPWFVPLNRTVPAPDNLPNYENTVVFSLSGFQYLILAAAVSKGAPFR 1061
Cdd:TIGR01657  924 PSNLFSVYILTSVLIQFVLHILSQVYLVFELHAQPWYKPENPVDLEKENFPNLLNTVLFFVSSFQYLITAIVNSKGPPFR 1003
                         1050      1060      1070      1080      1090
                   ....*....|....*....|....*....|....*....|....*....|.
gi 256985106  1062 QPLYTNVPFLVALALLGSVLVGLILVPGLLQGPLGLRNIVDSSFKLLLLGL 1112
Cdd:TIGR01657 1004 EPIYKNKPFVYLLITGLGLLLVLLLDPHPLLGKILQIVPLPQEFRSKLLVW 1054
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
197-1129 5.39e-152

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 481.45  E-value: 5.39e-152
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  197 SGLSLQDQATRKTIYGPNVISIP-------------VKSYLQLLADEALNPYYGFQAFSIAlwladHYYWYALCIFLISA 263
Cdd:COG0474    43 TGLSEEEVKRRLKKYGPNELPEEkkrsllkkflrqfKDPFIILLLVAALLSAFVGDWVDAG-----VDAIVILLVVVINA 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  264 ISICLALYKTRKQSLTLRDMVKLSVRVQvcRPGGEEEwVDSSELVPGDcLVLPQEGGVMPCDAALVAGEC-VVNESSLTG 342
Cdd:COG0474   118 LLGFVQEYRAEKALEALKKMSSPKAKVL--RDGKFVE-IPASELVPGD-IVLLEAGDVVPADLRLLESSDlEVDESALTG 193
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  343 ESTPVLKTALPEGPKPYCPETHRRHTLFCGTLILQARAyvgprvLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMK 422
Cdd:COG0474   194 ESLPVEKQALPLTKSDAPLGLDRDNMLFSGTTVVSGRA------KGIVVATGFETEFGKIARLLPTKKEVKTPLQRKLNK 267
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  423 FVAALSVLALLGTVYSIII-LYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGK 501
Cdd:COG0474   268 LGKFLLVLALVLGALVFVVgLFRGGNGLLESFLTALALAVAAVPEGLPAVVTIALALGAQRMAKDNAIVRSLNAIETLGS 347
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  502 LRLVCFDKTGTLTEDGLDVMGVVPLKGQVLLPLVPEPCHLPLGPLLRALATCHALSQLHD--TPVGDPMDLKMVESTGWV 579
Cdd:COG0474   348 VDVICSDKTGTLTQNKMTVKKIYINGGGKDIDDKDLKDSPALLRFLLAAALCNSVTPEKNgwYQAGDPTEGALVEFAEKL 427
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  580 leegpaagsapgsqvlvvmrpppGGPRQQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGAtQPEAYVKGSPELVASLCS- 658
Cdd:COG0474   428 -----------------------GFSLDLSGLEVEYPILAEIPFDSERKRMSVIVKTDEG-KYILFVKGAPEVILERCKs 483
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  659 -------PETVPSDFSQVLQSYTAAGYRVVALAGKPLPIAPSlaaaqQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQT 731
Cdd:COG0474   484 igeleplTEEGLRTLEEAVKELASEGLRVLAVAYKKLDRAEK-----DDEVDEIESDLVFLGLTGIEDPPREDVKEAIEE 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  732 LRKTGIRTVMVTGDNLQTAVTVARACGMVGAQEhlavihathpeqgqpaaleflptessavmngakatgyptvpepqsCH 811
Cdd:COG0474   559 LREAGIKVWMITGDHVETAIAIAKECGIEAEAE---------------------------------------------SA 593
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  812 LALSGSTFAVLRKHfpkLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQ--AEA 889
Cdd:COG0474   594 LVIDGAELDALSDE---ELAELVEELSVFARVSPEQKARIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGegTDA 670
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  890 S-VVSPFTSSMASIECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTN---LGDLQFLAIDLVITTTVAV 965
Cdd:COG0474   671 AkEAADIVLLDDNFATIVLAVVEGRRVYVNIKKFILYLLSKNVGEVLTLLIYSLFNLFflpLTPLQLLWINLLTDSLPAL 750
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  966 LMSRTGPALTLVR---ARPPGALLSVPVLGSLLLQVALVAGI-QLGGYFLViaqpWFVPLNRTVPAPDNLPNYENTVVFS 1041
Cdd:COG0474   751 ALGVEDPESDVMKrppRGPEEGLFNRKIFWRFILIIGLLSAIlFILTFLLY----LLGFIANTLGLDLFQALLQTTAFTV 826
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106 1042 LSGFQYLILAAAVSKGAPFRQP-LYTNVPFLVALALLGSVLVGLILVPGLLQGPLGLrnIVDSSFKLLLLGLVAFNFVGA 1120
Cdd:COG0474   827 LVLIQLLLTLAVRSRGRPFLSSlLFSNKYLWLALLVIIILQLLIIFLPPLNLKIFQP--TPLSLFEWLIAIAVALLLLYI 904

                  ....*....
gi 256985106 1121 FMLESVLDQ 1129
Cdd:COG0474   905 VVSELYKLK 913
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
179-887 1.47e-26

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 116.32  E-value: 1.47e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  179 QVSLLDHGRTCDDVHCSSSGLSLQDQATRKTIYGPNVISI--PVKSYLQLLaDEALNPyygfqaFSIALWLADHYYWY-- 254
Cdd:PRK10517   48 KAAVMPEEELWKTFDTHPEGLNEAEVESAREQHGENELPAqkPLPWWVHLW-VCYRNP------FNILLTILGAISYAte 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  255 ----ALCIFLISAISICLALY---KTRKQSLTLRDMVKLSVRVQVCRPG-GEEEWVDS--SELVPGDCLVLpQEGGVMPC 324
Cdd:PRK10517  121 dlfaAGVIALMVAISTLLNFIqeaRSTKAADALKAMVSNTATVLRVINDkGENGWLEIpiDQLVPGDIIKL-AAGDMIPA 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  325 DA-ALVAGECVVNESSLTGESTPVLKTALPEGPKPYCPethrrhtLFCGTLILQARAYVGPRVLAVVTRTGFCTAKGGLV 403
Cdd:PRK10517  200 DLrILQARDLFVAQASLTGESLPVEKFATTRQPEHSNP-------LECDTLCFMGTNVVSGTAQAVVIATGANTWFGQLA 272
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  404 SSILHP--RPISFKF--YKHSMKFVAALSVLAllgtvysIIILYRN---RVPVREIVIRALDLVTVVVPPALPaaMTVCT 476
Cdd:PRK10517  273 GRVSEQdsEPNAFQQgiSRVSWLLIRFMLVMA-------PVVLLINgytKGDWWEAALFALSVAVGLTPEMLP--MIVTS 343
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  477 LYAQS--RLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGL------DVMGvvplkgqvllplvpEPCHlplGPLLR 548
Cdd:PRK10517  344 TLARGavKLSKQKVIVKRLDAIQNFGAMDILCTDKTGTLTQDKIvlenhtDISG--------------KTSE---RVLHS 406
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  549 ALATCH---ALSQLHDTPVGDPMDL--KMVESTGWvleegpaagsapgsqvlvvmrpppggpRQQEEppvpvsvlcrFPF 623
Cdd:PRK10517  407 AWLNSHyqtGLKNLLDTAVLEGVDEesARSLASRW---------------------------QKIDE----------IPF 449
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  624 SSALQRMDVVVTWPGAtQPEAYVKGSPELVASLCS-----PETVPSDFS------QVLQSYTAAGYRVVALAGKPLPiap 692
Cdd:PRK10517  450 DFERRRMSVVVAENTE-HHQLICKGALEEILNVCSqvrhnGEIVPLDDImlrrikRVTDTLNRQGLRVVAVATKYLP--- 525
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  693 slaAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAvtvARACGMVGAqEHLAVIHAT 772
Cdd:PRK10517  526 ---AREGDYQRADESDLILEGYIAFLDPPKETTAPALKALKASGVTVKILTGDSELVA---AKVCHEVGL-DAGEVLIGS 598
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  773 HPEQgqpaaleflptessavMNGAKatgyptvpepqschlalsgstfavlrkhfpklLPKVLVQATVFARMAPEQKTELV 852
Cdd:PRK10517  599 DIET----------------LSDDE--------------------------------LANLAERTTLFARLTPMHKERIV 630
                         730       740       750
                  ....*....|....*....|....*....|....*
gi 256985106  853 CELQRLQYCVGMCGDGANDCGALKAADVGISLSQA 887
Cdd:PRK10517  631 TLLKREGHVVGFMGDGINDAPALRAADIGISVDGA 665
Hydrolase pfam00702
haloacid dehalogenase-like hydrolase; This family is structurally different from the alpha ...
675-767 8.30e-06

haloacid dehalogenase-like hydrolase; This family is structurally different from the alpha/beta hydrolase family (pfam00561). This family includes L-2-haloacid dehalogenase, epoxide hydrolases and phosphatases. The structure of the family consists of two domains. One is an inserted four helix bundle, which is the least well conserved region of the alignment. The rest of the fold is composed of the core alpha/beta domain. Those members with the characteristic DxD triad at the N-terminus are probably phosphatidylglycerolphosphate (PGP) phosphatases involved in cardiolipin biosynthesis in the mitochondria.


Pssm-ID: 279092 [Multi-domain]  Cd Length: 190  Bit Score: 46.42  E-value: 8.30e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   675 AAGYRVVALAGKP-----LPIAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQT 749
Cdd:pfam00702   47 VEDFTARLLLGKRdwleeLGLRGLVETLEAEGLTVVLVELLGVIALADELKLYPGAAEALKALKEKGIKVAILTGDNPEA 126
                           90
                   ....*....|....*...
gi 256985106   750 AVTVARACGMVGAQEHLA 767
Cdd:pfam00702  127 AEALLRLLGLDDYFDVVI 144
 
Name Accession Description Interval E-value
E1-E2_ATPase pfam00122
E1-E2 ATPase;
258-493 1.32e-32

E1-E2 ATPase;


Pssm-ID: 278548  Cd Length: 221  Bit Score: 127.68  E-value: 1.32e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   258 IFLISAISICLALYKTRKQSLTLRDMVKLSVR-VQVCRPGGEEEwVDSSELVPGDcLVLPQEGGVMPCDAALVAGECVVN 336
Cdd:pfam00122    3 ILLLVLLNALLEFYQEARARKALKALKSLLPPtATVLRDGGEVE-VPADELVPGD-IVLLKPGERIPADGRIVEGSLSVD 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   337 ESSLTGESTPVLKtalpegpkpycpetHRRHTLFCGTLILQARAyvgprvLAVVTRTGFCTAKGGLVSSILH----PRPI 412
Cdd:pfam00122   81 ESALTGESLPVEK--------------KKGDMVFSGTVVVSGSA------KAVVTATGEDTTLGKIARLVEEakskKTPL 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   413 SFKFYKHSMKFVAALSVLALLgtvySIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIH 492
Cdd:pfam00122  141 QRLLDKLAKYFTPVVLLLALA----VFLLTLLLGGDLAEALLRALAVLVAACPCALPLATPLALAVGARRLAKKGILVKR 216

                   .
gi 256985106   493 P 493
Cdd:pfam00122  217 L 217
P5-ATPase pfam12409
P5-type ATPase cation transporter; This domain family is found in eukaryotes, and is typically ...
35-161 1.65e-22

P5-type ATPase cation transporter; This domain family is found in eukaryotes, and is typically between 110 and 126 amino acids in length. The family is found in association with pfam00122, pfam00702. P-type ATPases comprise a large superfamily of proteins, present in both prokaryotes and eukaryotes, that transport inorganic cations and other substrates across cell membranes.


Pssm-ID: 289194  Cd Length: 118  Bit Score: 95.26  E-value: 1.65e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106    35 VRLSGYCGSPWRAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIeikdkEGSSRQLFTVQVQTEAVVQ 114
Cdd:pfam12409    5 IEIAGYRTSRWRLALYYLLCVLTLGLLYLLFRWLPRWRVRLTGKPCPLAEADWVVI-----EDQWGELSIKKVKSEPYGR 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 256985106   115 G-SLELPPqaqaedgrsqaAVGVTPEGTWQDTSELHrqeEAKQVLRYY 161
Cdd:pfam12409   80 PlSTVFPL-----------EDGESDSVASHDDEEND---PILPKLRYF 113
COG4087 COG4087
Soluble P-type ATPase [General function prediction only];
839-888 1.82e-05

Soluble P-type ATPase [General function prediction only];


Pssm-ID: 226572  Cd Length: 152  Bit Score: 44.86  E-value: 1.82e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 256985106  839 VFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAE 888
Cdd:COG4087    73 VFAGADPEMKAKIIRELKKRYEKVVMVGNGANDILALREADLGICTIQQE 122
Cation_ATPase pfam13246
Cation transport ATPase (P-type); This domain is found in cation transport ATPases, including ...
621-658 3.45e-04

Cation transport ATPase (P-type); This domain is found in cation transport ATPases, including phospholipid-transporting ATPases, calcium-transporting ATPases, and sodium-potassium ATPases.


Pssm-ID: 289987  Cd Length: 93  Bit Score: 40.32  E-value: 3.45e-04
                           10        20        30
                   ....*....|....*....|....*....|....*...
gi 256985106   621 FPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCS 658
Cdd:pfam13246   54 IPFNSDRKRMSVVHKLEDDGYRLLFVKGAPERILERCT 91
Cation_ATPase_N smart00831
Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region ...
188-260 8.06e-04

Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases.


Pssm-ID: 214842  Cd Length: 75  Bit Score: 39.10  E-value: 8.06e-04
                            10        20        30        40        50        60        70
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 256985106    188 TCDDVHCS-SSGLSLQDQATRKTIYGPNVISIPVK-SYLQLLADEALNPyygfqaFSIALWLADhyywyALCIFL 260
Cdd:smart00831   12 VLERLQTDlEKGLSSEEAARRLERYGPNELPPPKKtSPLLRFLRQFHNP------LIYILLAAA-----VLSALL 75
Cation_ATPase_N pfam00690
Cation transporter/ATPase, N-terminus; Members of this families are involved in Na+/K+, H+/K+, ...
194-248 9.00e-03

Cation transporter/ATPase, N-terminus; Members of this families are involved in Na+/K+, H+/K+, Ca++ and Mg++ transport.


Pssm-ID: 279080  Cd Length: 69  Bit Score: 35.97  E-value: 9.00e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 256985106   194 CSSSGLSLQDQATRKTIYGPNVIS-IPVKSYLQLLADEALNPyygfqaFSIALWLA 248
Cdd:pfam00690   16 DSEKGLTEEEAEERLEKYGPNELPeKKKKSLWLIFLRQFKNP------LIIILLVA 65
P-ATPase-V TIGR01657
P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade ...
35-1112 0e+00

P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in.


Pssm-ID: 273738 [Multi-domain]  Cd Length: 1054  Bit Score: 1337.01  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106    35 VRLSGYCGSPWRAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIEIKdkegssrqlftvqvQTEAVVQ 114
Cdd:TIGR01657    4 IGISAYKISPFKLIIYLVTLILTFGLVLLLLTWLPEWKVKLRYVPVSNEDAETVVIVDP--------------TPNSGSD 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   115 GSLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVlryyvlqgqrYVWMETQQAFCQVSlldHGRTCDDVHc 194
Cdd:TIGR01657   70 YIVELSNKSLSNDLQTENAVEGGEEPIYFDFRKQRFSYHEKEL----------KIFSPLPYLFKEKS---FGVYSTCAG- 135
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   195 SSSGLSLQDQATRKTIYGPNVISIPVKSYLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLALYKTR 274
Cdd:TIGR01657  136 HSNGLTTGDIAQRKAKYGKNEIEIPVPSFLELLKEEVLHPFYVFQVFSVILWLLDEYYYYSLCIVFMSSTSISLSVYQIR 215
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   275 KQSLTLRDMVKLSVRVQVCRPGgEEEWVDSSELVPGDCLVLP-QEGGVMPCDAALVAGECVVNESSLTGESTPVLKTALP 353
Cdd:TIGR01657  216 KQMQRLRDMVHKPQSVIVIRNG-KWVTIASDELVPGDIVSIPrPEEKTMPCDSVLLSGSCIVNESMLTGESVPVLKFPIP 294
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   354 EG----PKPYCPETHRRHTLFCGTLILQARAYVGPR-VLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMKFVAALS 428
Cdd:TIGR01657  295 DNgdddEDLFLYETSKKHVLFGGTKILQIRPYPGDTgCLAIVVRTGFSTSKGQLVRSILYPKPRVFKFYKDSFKFILFLA 374
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   429 VLALLGTVYSIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFD 508
Cdd:TIGR01657  375 VLALIGFIYTIIELIKDGRPLGKIILRSLDIITIVVPPALPAELSIGINNSLARLKKKGIFCTSPFRINFAGKIDVCCFD 454
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   509 KTGTLTEDGLDVMGVVPLKG-QVLLPLVPEPCHLPLGPLLRALATCHALSQLHDTPVGDPMDLKMVESTGWVLEEgpAAG 587
Cdd:TIGR01657  455 KTGTLTEDGLDLRGVQGLSGnQEFLKIVTEDSSLKPSITHKALATCHSLTKLEGKLVGDPLDKKMFEATGWTLEE--DDE 532
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   588 SAPGSQVLVVMRpppggprqQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCSPETVPSDFS 667
Cdd:TIGR01657  533 SAEPTSILAVVR--------TDDPPQELSIIRRFQFSSALQRMSVIVSTNDERSPDAFVKGAPETIQSLCSPETVPSDYQ 604
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   668 QVLQSYTAAGYRVVALAGKPLPiAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNL 747
Cdd:TIGR01657  605 EVLKSYTREGYRVLALAYKELP-KLTLQKAQDLSRDAVESNLTFLGFIVFENPLKPDTKEVIKELKRASIRTVMITGDNP 683
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   748 QTAVTVARACGMVGAQEHLAVIHATHPEQGQPAALEFLPTESSAVMNGAKATGYP----TVPEPQSC--HLALSGSTFAV 821
Cdd:TIGR01657  684 LTAVHVARECGIVNPSNTLILAEAEPPESGKPNQIKFEVIDSIPFASTQVEIPYPlgqdSVEDLLASryHLAMSGKAFAV 763
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   822 LRKHFPKLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMAS 901
Cdd:TIGR01657  764 LQAHSPELLLRLLSHTTVFARMAPDQKETLVELLQKLDYTVGMCGDGANDCGALKQADVGISLSEAEASVAAPFTSKLAS 843
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   902 IECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTLVRARP 981
Cdd:TIGR01657  844 ISCVPNVIREGRCALVTSFQMFKYMALYSLIQFYSVSILYLIGSNLGDGQFLTIDLLLIFPVALLMSRNKPLKKLSKERP 923
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   982 PGALLSVPVLGSLLLQVALVAGIQLGGYFLVIAQPWFVPLNRTVPAPDNLPNYENTVVFSLSGFQYLILAAAVSKGAPFR 1061
Cdd:TIGR01657  924 PSNLFSVYILTSVLIQFVLHILSQVYLVFELHAQPWYKPENPVDLEKENFPNLLNTVLFFVSSFQYLITAIVNSKGPPFR 1003
                         1050      1060      1070      1080      1090
                   ....*....|....*....|....*....|....*....|....*....|.
gi 256985106  1062 QPLYTNVPFLVALALLGSVLVGLILVPGLLQGPLGLRNIVDSSFKLLLLGL 1112
Cdd:TIGR01657 1004 EPIYKNKPFVYLLITGLGLLLVLLLDPHPLLGKILQIVPLPQEFRSKLLVW 1054
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
197-1129 5.39e-152

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 481.45  E-value: 5.39e-152
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  197 SGLSLQDQATRKTIYGPNVISIP-------------VKSYLQLLADEALNPYYGFQAFSIAlwladHYYWYALCIFLISA 263
Cdd:COG0474    43 TGLSEEEVKRRLKKYGPNELPEEkkrsllkkflrqfKDPFIILLLVAALLSAFVGDWVDAG-----VDAIVILLVVVINA 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  264 ISICLALYKTRKQSLTLRDMVKLSVRVQvcRPGGEEEwVDSSELVPGDcLVLPQEGGVMPCDAALVAGEC-VVNESSLTG 342
Cdd:COG0474   118 LLGFVQEYRAEKALEALKKMSSPKAKVL--RDGKFVE-IPASELVPGD-IVLLEAGDVVPADLRLLESSDlEVDESALTG 193
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  343 ESTPVLKTALPEGPKPYCPETHRRHTLFCGTLILQARAyvgprvLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMK 422
Cdd:COG0474   194 ESLPVEKQALPLTKSDAPLGLDRDNMLFSGTTVVSGRA------KGIVVATGFETEFGKIARLLPTKKEVKTPLQRKLNK 267
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  423 FVAALSVLALLGTVYSIII-LYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGK 501
Cdd:COG0474   268 LGKFLLVLALVLGALVFVVgLFRGGNGLLESFLTALALAVAAVPEGLPAVVTIALALGAQRMAKDNAIVRSLNAIETLGS 347
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  502 LRLVCFDKTGTLTEDGLDVMGVVPLKGQVLLPLVPEPCHLPLGPLLRALATCHALSQLHD--TPVGDPMDLKMVESTGWV 579
Cdd:COG0474   348 VDVICSDKTGTLTQNKMTVKKIYINGGGKDIDDKDLKDSPALLRFLLAAALCNSVTPEKNgwYQAGDPTEGALVEFAEKL 427
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  580 leegpaagsapgsqvlvvmrpppGGPRQQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGAtQPEAYVKGSPELVASLCS- 658
Cdd:COG0474   428 -----------------------GFSLDLSGLEVEYPILAEIPFDSERKRMSVIVKTDEG-KYILFVKGAPEVILERCKs 483
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  659 -------PETVPSDFSQVLQSYTAAGYRVVALAGKPLPIAPSlaaaqQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQT 731
Cdd:COG0474   484 igeleplTEEGLRTLEEAVKELASEGLRVLAVAYKKLDRAEK-----DDEVDEIESDLVFLGLTGIEDPPREDVKEAIEE 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  732 LRKTGIRTVMVTGDNLQTAVTVARACGMVGAQEhlavihathpeqgqpaaleflptessavmngakatgyptvpepqsCH 811
Cdd:COG0474   559 LREAGIKVWMITGDHVETAIAIAKECGIEAEAE---------------------------------------------SA 593
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  812 LALSGSTFAVLRKHfpkLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQ--AEA 889
Cdd:COG0474   594 LVIDGAELDALSDE---ELAELVEELSVFARVSPEQKARIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGegTDA 670
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  890 S-VVSPFTSSMASIECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTN---LGDLQFLAIDLVITTTVAV 965
Cdd:COG0474   671 AkEAADIVLLDDNFATIVLAVVEGRRVYVNIKKFILYLLSKNVGEVLTLLIYSLFNLFflpLTPLQLLWINLLTDSLPAL 750
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  966 LMSRTGPALTLVR---ARPPGALLSVPVLGSLLLQVALVAGI-QLGGYFLViaqpWFVPLNRTVPAPDNLPNYENTVVFS 1041
Cdd:COG0474   751 ALGVEDPESDVMKrppRGPEEGLFNRKIFWRFILIIGLLSAIlFILTFLLY----LLGFIANTLGLDLFQALLQTTAFTV 826
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106 1042 LSGFQYLILAAAVSKGAPFRQP-LYTNVPFLVALALLGSVLVGLILVPGLLQGPLGLrnIVDSSFKLLLLGLVAFNFVGA 1120
Cdd:COG0474   827 LVLIQLLLTLAVRSRGRPFLSSlLFSNKYLWLALLVIIILQLLIIFLPPLNLKIFQP--TPLSLFEWLIAIAVALLLLYI 904

                  ....*....
gi 256985106 1121 FMLESVLDQ 1129
Cdd:COG0474   905 VVSELYKLK 913
ATPase_P-type TIGR01494
ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large ...
257-967 1.36e-133

ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large family of trans-membrane transporters acting on charged substances. The distinguishing feature of the family is the formation of a phosphorylated intermediate (aspartyl-phosphate) during the course of the reaction. Another common name for these enzymes is the E1-E2 ATPases based on the two isolable conformations: E1 (unphosphorylated) and E2 (phosphorylated). Generally, P-type ATPases consist of only a single subunit encompassing the ATPase and ion translocation pathway, however, in the case of the potassium (TIGR01497) and sodium/potassium (TIGR01106) varieties, these functions are split between two subunits. Additional small regulatory or stabilizing subunits may also exist in some forms. P-type ATPases are nearly ubiquitous in life and are found in numerous copies in higher organisms (at least 45 in Arabidopsis thaliana, for instance). Phylogenetic analyses have revealed that the P-type ATPase subfamily is divided up into groups based on substrate specificities and this is represented in the various subfamily and equivalog models that have been made: IA (K+) TIGR01497, IB (heavy metals) TIGR01525, IIA1 (SERCA-type Ca++) TIGR01116, IIA2 (PMR1-type Ca++) TIGR01522, IIB (PMCA-type Ca++) TIGR01517, IIC (Na+/K+, H+/K+ antiporters) TIGR01106, IID (fungal-type Na+ and K+) TIGR01523, IIIA (H+) TIGR01647, IIIB (Mg++) TIGR01524, IV (phospholipid, flippase) TIGR01652 and V (unknown specificity) TIGR01657. The crystal structure of one calcium-pumping ATPase and an analysis of the fold of the catalytic domain of the P-type ATPases have been published. These reveal that the catalytic core of these enzymes is a haloacid dehalogenase(HAD)-type aspartate-nucleophile hydrolase. The location of the ATP-binding loop in between the first and second HAD conserved catalytic motifs defines these enzymes as members of subfamily I of the HAD superfamily (see also TIGR01493, TIGR01509, TIGR01549, TIGR01544 and TIGR01545). Based on these classifications, the P-type ATPase _superfamily_ corresponds to the IC subfamily of the HAD superfamily.


Pssm-ID: 273656 [Multi-domain]  Cd Length: 545  Bit Score: 420.57  E-value: 1.36e-133
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   257 CIFLISAISICLALY---KTRKQSLTLRDMVKLSVRVQVCRPGGEeeWVDSSELVPGDCLVLPqEGGVMPCDAALVAGEC 333
Cdd:TIGR01494    1 FILFLVLLFVLLEVKqklKAEDALRSLKDSLVNTATVLVLRNGWK--EISSKDLVPGDVVLVK-SGDTVPADGVLLSGSA 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   334 VVNESSLTGESTPVLKTALPEGPKPycpetHRRHTLFCGTLILQARAYVG---PRVLAVVTRTGFCTakgglvSSILHPR 410
Cdd:TIGR01494   78 FVDESSLTGESLPVLKTALPDGDAV-----FAGTINFGGTLIVKVTATGIlttVGKIAVVVYTGFST------KTPLQSK 146
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   411 PISFKFykhsMKFVAALSVLALLGTVYSIIILYRNRvPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFC 490
Cdd:TIGR01494  147 ADKFEN----FIFILFLLLLALAVFLLLPIGGWDGN-SIYKAILRALAVLVIAIPCALPLAVSVALAVGDARMAKKGILV 221
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   491 IHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLKGQVLLplvpepchLPLGPLLRALATCHalsqlhdtpVGDPMDL 570
Cdd:TIGR01494  222 KNLNALEELGKVDVICFDKTGTLTTNKMTLQKVIIIGGVEEA--------SLALALLAASLEYL---------SGHPLER 284
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   571 KMVESTGWVLEEgpaagsapgsqvlvvmrpppggprqqEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQpEAYVKGSP 650
Cdd:TIGR01494  285 AIVKSAEGVIKS--------------------------DEINVEYKILDVFPFSSVLKRMGVIVEGANGSD-LLFVKGAP 337
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   651 ELVASLCSPEtvpSDFSQVLQSYTAAGYRVVALAGKPLPiapslaaaqqltrdtveRELSLLGLLVMRNLLKPQTAPVIQ 730
Cdd:TIGR01494  338 EFVLERCNNE---NDYDEKVDEYARQGLRVLAFASKKLP-----------------DDLEFLGLLTFEDPLRPDAKETIE 397
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   731 TLRKTGIRTVMVTGDNLQTAVTVARACGMVgaqehlavihathpeqgqpaaleflptessavmngakatgyptvpepqsc 810
Cdd:TIGR01494  398 ALRKAGIKVVMLTGDNVLTAKAIAKELGID-------------------------------------------------- 427
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   811 hlalsgstfavlrkhfpkllpkvlvqatVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQ---A 887
Cdd:TIGR01494  428 ----------------------------VFARVKPEEKAAIVEALQEKGRTVAMTGDGVNDAPALKKADVGIAMGSgdvA 479
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   888 EASVVSPFTSSmaSIECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINtnlgdlqflaidLVITTTVAVLM 967
Cdd:TIGR01494  480 KAAADIVLLDD--DLSTIVEAVKEGRKTFSNIKKNIFWAIAYNLILIPLALLLIVII------------LLPPLLAALAL 545
ATPase-IIA2_Ca TIGR01522
golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
200-886 1.02e-39

golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.


Pssm-ID: 130585 [Multi-domain]  Cd Length: 884  Bit Score: 158.46  E-value: 1.02e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   200 SLQDQATRKTIYGPNVISIP-----VKSYL-QLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISIcLALYKT 273
Cdd:TIGR01522   26 SSQEASHRRAFHGWNEFDVEedeslWKKFLsQFVKNPLILLLIASAVISVFMGNIDDAVSITLAILIVVTVGF-VQEYRS 104
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   274 RKQSLTLRDMVKLSVRVQVCrpgGEEEWVDSSELVPGDcLVLPQEGGVMPCDAALV-AGECVVNESSLTGESTPVLKTAL 352
Cdd:TIGR01522  105 EKSLEALNKLVPPECHLIRE---GKLEHVLASTLVPGD-LVCLSVGDRVPADLRIVeAVDLSIDESNLTGETTPVSKVTA 180
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   353 PEGPKPYCPETHRRHTLFCGTLILQARAYvgprvlAVVTRTGFCTAKGG---LVSSILHPR-PI--SFKFYKHSMKFVA- 425
Cdd:TIGR01522  181 PIPAATNGDLAERSNIAFMGTLVRCGHGK------GIVVGTGSNTEFGAvfkMMQAIEKPKtPLqkSMDLLGKQLSLVSf 254
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   426 -ALSVLALLGtvysiIILYRNRVPVREIvirALDLVTVVVPPALPAAMTVCTLYAQSRL-RTQGIFCIHPLRINLgGKLR 503
Cdd:TIGR01522  255 gVIGVICLVG-----WFQGKDWLEMFTI---SVSLAVAAIPEGLPIIVTVTLALGVLRMsKKRAIVRKLPSVETL-GSVN 325
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   504 LVCFDKTGTLTE-----------DGLDVM-GVVPLKGQVLLPLVPEPCHLPLGPLLRALATCHAL------SQLHDTPVG 565
Cdd:TIGR01522  326 VICSDKTGTLTKnhmtvtkiwtsDGLHTMlNAVSLNQFGEVIVDGDVLHGFYTVAVSRILEAGNLcnnakfRNEADTLLG 405
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   566 DPMDLKMVEstgwvleegpaagsapgsqvlVVMRPPPGGPRQQeeppvpVSVLCRFPFSSALQRMDVVVTWPGATQPEAY 645
Cdd:TIGR01522  406 NPTDVALIE---------------------LLMKFGLDDLRET------YIRVAEVPFSSERKWMAVKCVHRQDRSEMCF 458
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   646 VKGSPELVASLCS--------PETVPSDFSQVLQ----SYTAAGYRVVALAGKPLpiapslaaaqqltrdtvERELSLLG 713
Cdd:TIGR01522  459 MKGAYEQVLKYCTyyqkkdgkTLTLTQQQRDVIQeeaaEMASAGLRVIAFASGPE-----------------KGQLTFLG 521
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   714 LLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMvgaqehlavihathpeqgqpaaleflptessavm 793
Cdd:TIGR01522  522 LVGINDPPRPGVKEAVTTLITGGVRIIMITGDSQETAVSIARRLGM---------------------------------- 567
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   794 ngakatgypTVPEPQSchlaLSGSTFAVLRKhfpKLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCG 873
Cdd:TIGR01522  568 ---------PSKTSQS----VSGEKLDAMDD---QQLSQIVPKVAVFARASPEHKMKIVKALQKRGDVVAMTGDGVNDAP 631
                          730
                   ....*....|...
gi 256985106   874 ALKAADVGISLSQ 886
Cdd:TIGR01522  632 ALKLADIGVAMGQ 644
ATPase-IIB_Ca TIGR01517
plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
198-1082 1.54e-38

plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes, out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes. In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects. The calcium P-type ATPases have been characterized as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump. A separate analysis divides Type IIA into sub-types (SERCA and PMR1) which are represented by two corresponding models (TIGR01116 and TIGR01522). This model is well separated from those.


Pssm-ID: 273668 [Multi-domain]  Cd Length: 956  Bit Score: 154.94  E-value: 1.54e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   198 GLSLQ--DQATRKTIYGPNVIS-IPVKSYLQL----LADEALNPYYGFQAFSIALWLADHYY----------WY------ 254
Cdd:TIGR01517   59 GVRLSssTLERREKVYGKNELPeKPPKSFLQIvwaaLSDQTLILLSVAAVVSLVLGLYVPSVgedkadtetgWIegvail 138
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   255 --ALCIFLISAISiclalykTRKQSLTLRDMVKLS--VRVQVCRpGGEEEWVDSSELVPGDCLVLpQEGGVMPCDAALVA 330
Cdd:TIGR01517  139 vsVILVVLVTAVN-------DYKKELQFRQLNREKsaQKIAVIR-GGQEQQISIHDIVVGDIVSL-STGDVVPADGVFIS 209
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   331 G-ECVVNESSLTGESTPVlKTALPEGPkpycpethrrhTLFCGTLILQARAYVgprvlaVVTRTGFCTAKGGLVSSILHP 409
Cdd:TIGR01517  210 GlSLEIDESSITGESDPI-KKGPVQDP-----------FLLSGTVVNEGSGRM------LVTAVGVNSFGGKLMMELRQA 271
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   410 RPISFKFYKHSMKFVAALSVLALLGTVYSIIIL------YRNRVPVR------------EIVIRALDLVTVVVPPALPAA 471
Cdd:TIGR01517  272 GEEETPLQEKLSELAGLIGKFGMGSAVLLFLVLslryvfRIIRGDGRfedteedaqtflDHFIIAVTIVVVAVPEGLPLA 351
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   472 MTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPlkGQVLLPLVPEPCHLPLGPLLRALA 551
Cdd:TIGR01517  352 VTIALAYSMKKMMKDNNLVRHLAACETMGSATAICSDKTGTLTQNVMSVVQGYI--GEQRFNVRDEIVLRNLPAAVRNIL 429
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   552 TcHALSQLHDTPVGdpmdlkmVESTGWVLEEGPAAGSAPGSQVLVVMRP--PPGGPRQQEEppvpvsVLCRFPFSSALQR 629
Cdd:TIGR01517  430 V-EGISLNSSSEEV-------VDRGGKRAFIGSKTECALLDFGLLLLLQsrDVQEVRAEEK------VVKIYPFNSERKF 495
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   630 MDVVVTWPGATQpEAYVKGSPELVASLCSP------ETVP------SDFSQVLQSYTAAGYRVVALAGKplpiapSLAAA 697
Cdd:TIGR01517  496 MSVVVKHSGGKY-REFRKGASEIVLKPCRKrldsngEATPiseddkDRCADVIEPLASDALRTICLAYR------DFAPE 568
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   698 QQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVGAQEhlavihathpeqg 777
Cdd:TIGR01517  569 EFPRKDYPNKGLTLIGVVGIKDPLRPGVREAVQECQRAGITVRMVTGDNIDTAKAIARNCGILTFGG------------- 635
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   778 qpaaleflptessavmngakatgyptvpepqschLALSGSTFAVLRKH-FPKLLPKVlvqaTVFARMAPEQKTELVCELQ 856
Cdd:TIGR01517  636 ----------------------------------LAMEGKEFRSLVYEeMDPILPKL----RVLARSSPLDKQLLVLMLK 677
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   857 RLQYCVGMCGDGANDCGALKAADVGISLSQA------EASVVSPFTSSMASIEcvpTVIREGRCSLDtsfSVFKYMALyS 930
Cdd:TIGR01517  678 DMGEVVAVTGDGTNDAPALKLADVGFSMGISgtevakEASDIILLDDNFASIV---RAVKWGRNVYD---NIRKFLQF-Q 750
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   931 LT--------QFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTLVRARPPG---ALLSVPVLGSLLLQva 999
Cdd:TIGR01517  751 LTvnvvavilTFVGSCISSSHTSPLTAVQLLWVNLIMDTLAALALATEPPTEALLDRKPIGrnaPLISRSMWKNILGQ-- 828
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  1000 lvAGIQLGGYFLVI-AQPWFVPLNRTVPAPDNLPNYENTVVFS---LSGFQYLILAAAVSKGAPFRQPLYTNVPFLVALA 1075
Cdd:TIGR01517  829 --AGYQLVVTFILLfAGGSIFDVSGPDEITSHQQGELNTIVFNtfvLLQLFNEINARKLYEGMNVFEGLFKNRIFVTIMG 906

                   ....*..
gi 256985106  1076 LLGSVLV 1082
Cdd:TIGR01517  907 FTFGFQV 913
ATPase-IID_K-Na TIGR01523
potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium ...
196-958 5.44e-32

potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium efflux ATPase, more recent work has shown that the S. pombe CTA3 gene is in fact a potassium ion efflux pump. This model describes the clade of fungal P-type ATPases responsible for potassium and sodium efflux. The degree to which these pumps show preference for sodium or potassium varies. This group of ATPases has been classified by phylogentic analysis as type IID. The Leishmania sequence (GP|3192903), which falls between trusted and noise in this model, may very well turn out to be an active potassium pump.


Pssm-ID: 130586 [Multi-domain]  Cd Length: 1053  Bit Score: 133.98  E-value: 5.44e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   196 SSGLSLQDQATRKTIYGPNVISIPVK-SYLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLAL---Y 271
Cdd:TIGR01523   24 PEGLTHDEAQHRLKEVGENRLEADSGiDAKAMLLHQVCNAMCMVLIIAAAISFAMHDWIEGGVISAIIALNILIGFiqeY 103
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   272 KTRKQSLTLRDMVklSVRVQVCRpGGEEEWVDSSELVPGDCLVLpQEGGVMPCDAALVagECV---VNESSLTGESTPVL 348
Cdd:TIGR01523  104 KAEKTMDSLKNLA--SPMAHVIR-NGKSDAIDSHDLVPGDICLL-KTGDTIPADLRLI--ETKnfdTDEALLTGESLPVI 177
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   349 KTA-LPEGPKPYCPETHRRHTLFCGTLILQARAYvgprvlAVVTRTGFCT----------AKGGLVSSILHPRP----IS 413
Cdd:TIGR01523  178 KDAhATFGKEEDTPIGDRINLAFSSSAVTKGRAK------GICIATALNSeigaiaaglqGDGGLFQRPEKDDPnkrrKL 251
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   414 FKFYKHSMKFVAA--------------LSVLALL----GTVYSIIILYRNRVPV-REIVIRALDLVTVVVPPALPAAMTV 474
Cdd:TIGR01523  252 NKWILKVTKKVTGaflglnvgtplhrkLSKLAVIlfciAIIFAIIVMAAHKFDVdKEVAIYAICLAISIIPESLIAVLSI 331
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   475 CTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVV-----------------PLKGQV-LLPLVP 536
Cdd:TIGR01523  332 TMAMGAANMSKRNVIVRKLDALEALGAVNDICSDKTGTITQGKMIARQIWiprfgtisidnsddafnPNEGNVsGIPRFS 411
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   537 E--------------------------PCHLPLG---PLLRALATCHALSQLHDTPV------GDPMDLKM-VESTGWVL 580
Cdd:TIGR01523  412 PyeyshneaadqdilkefkdelkeidlPEDIDMDlfiKLLETAALANIATVFKDDATdcwkahGDPTEIAIhVFAKKFDL 491
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   581 EEGPAAGSapgSQVLVVMRPPPGGPRQQEEPPVPVSV--LCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCS 658
Cdd:TIGR01523  492 PHNALTGE---EDLLKSNENDQSSLSQHNEKPGSAQFefIAEFPFDSEIKRMASIYEDNHGETYNIYAKGAFERIIECCS 568
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   659 -----------PETVPSDFSQVLQSYT--AAGYRVVALAGKPLPIA---PSLAAAQQLTRDTVERELSLLGLLVMRNLLK 722
Cdd:TIGR01523  569 ssngkdgvkisPLEDCDRELIIANMESlaAEGLRVLAFASKSFDKAdnnDDQLKNETLNRATAESDLEFLGLIGIYDPPR 648
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   723 PQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVGAQehlaVIHATHPEQgqpaaleflpteSSAVMngakatgyp 802
Cdd:TIGR01523  649 NESAGAVEKCHQAGINVHMLTGDFPETAKAIAQEVGIIPPN----FIHDRDEIM------------DSMVM--------- 703
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   803 tvpepqschlalSGSTFAVLRKHFPKLLPkvlVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGI 882
Cdd:TIGR01523  704 ------------TGSQFDALSDEEVDDLK---ALCLVIARCAPQTKVKMIEALHRRKAFCAMTGDGVNDSPSLKMANVGI 768
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   883 SLSQ------AEASVVSPFTSSMASIecvPTVIREGRcsldtsfsvfkymalySLTQFISVLILYTINTNLGDLQFLAID 956
Cdd:TIGR01523  769 AMGIngsdvaKDASDIVLSDDNFASI---LNAIEEGR----------------RMFDNIMKFVLHLLAENVAEAILLIIG 829

                   ..
gi 256985106   957 LV 958
Cdd:TIGR01523  830 LA 831
ATPase-IIIB_Mg TIGR01524
magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ...
197-959 1.03e-31

magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ATPase found in a limited number of bacterial species and best described in Salmonella typhimurium, which contains two isoforms. These transporters are active in low external Mg2+ concentrations and pump the ion into the cytoplasm. The magnesium ATPases have been classified as type IIIB by a phylogenetic analysis. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 130587 [Multi-domain]  Cd Length: 867  Bit Score: 132.68  E-value: 1.03e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   197 SGLSLQDQATRKTIYGPN-VISIPVKSYLQLLADEALNPY-YGFQAFSIALWLADHYYwYALCIFLISAISICLAL---Y 271
Cdd:TIGR01524   32 TGLTNVEVTERLAEFGPNqTVEEKKVPNLRLLIRAFNNPFiYILAMLMGVSYLTDDLE-ATVIIALMVLASGLLGFiqeS 110
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   272 KTRKQSLTLRDMVKLSV---RVQVCRPGGEEEWVDSSELVPGDcLVLPQEGGVMPCDAALVAG-ECVVNESSLTGESTPV 347
Cdd:TIGR01524  111 RAERAAYALKNMVKNTAtvlRVINENGNGSMDEVPIDALVPGD-LIELAAGDIIPADARVISArDLFINQSALTGESLPV 189
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   348 LKTALPEGPKPYCPethrrhtLFCGTLILQARAYVGPRVLAVVTRTGFCTAKGGLVSSILHPRPISFkfYKHSMKFVAAL 427
Cdd:TIGR01524  190 EKFVEDKRARDPEI-------LERENLCFMGTNVLSGHAQAVVLATGSSTWFGSLAIAATERRGQTA--FDKGVKSVSKL 260
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   428 SVLALLgtVYSIIILYRNRVPVREIVIRALDLVTVVV---PPALPaaMTVCTLYAQS--RLRTQGIFCIHPLRINLGGKL 502
Cdd:TIGR01524  261 LIRFML--VMVPVVLMINGLMKGDWLEAFLFALAVAVgltPEMLP--MIVSSNLAKGaiNMSKKKVIVKELSAIQNFGAM 336
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   503 RLVCFDKTGTLTEDGLDVMGVVPLKGQvllplvpepchlplgPLLRALaTCHALSQLHDTPVGDPMDLKMVEStgwvLEE 582
Cdd:TIGR01524  337 DILCTDKTGTLTQDKIELEKHIDSSGE---------------TSERVL-KMAWLNSYFQTGWKNVLDHAVLAK----LDE 396
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   583 GPAAGSApgsqvlvvmrpppGGPRQQEEppvpvsvlcrFPFSSALQRMDVVVTwPGATQPEAYVKGSPELVASLCS---- 658
Cdd:TIGR01524  397 SAARQTA-------------SRWKKVDE----------IPFDFDRRRLSVVVE-NRAEVTRLICKGAVEEMLTVCThkrf 452
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   659 -------PETVPSDFSQVLQSYTAAGYRVVALAGKPLPiapslAAAQQLTRdTVERELSLLGLLVMRNLLKPQTAPVIQT 731
Cdd:TIGR01524  453 ggavvtlSESEKSELQDMTAEMNRQGIRVIAVATKTLK-----VGEADFTK-TDEEQLIIEGFLGFLDPPKESTKEAIAA 526
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   732 LRKTGIRTVMVTGDNlqtAVTVARACGMVGAQEHlavihathpeqgqpaaleflptessAVMNGAKATGyptvpepqsch 811
Cdd:TIGR01524  527 LFKNGINVKVLTGDN---EIVTARICQEVGIDAN-------------------------DFLLGADIEE----------- 567
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   812 laLSGSTFAVLrkhfpkllpkvLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQaeASV 891
Cdd:TIGR01524  568 --LSDEELARE-----------LRKYHIFARLTPMQKSRIIGLLKKAGHTVGFLGDGINDAPALRKADVGISVDT--AAD 632
                          730       740       750       760       770       780
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 256985106   892 VSPFTSSMASIECVPTVIREGRCSLDTSFS-VFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVI 959
Cdd:TIGR01524  633 IAKEASDIILLEKSLMVLEEGVIEGRNTFGnILKYLKMTASSNFGNVFSVLVASAFIPFLPMLSLHLLI 701
ATPase-IB_hvy TIGR01525
heavy metal translocating P-type ATPase; This model encompasses two equivalog models for the ...
251-885 5.18e-30

heavy metal translocating P-type ATPase; This model encompasses two equivalog models for the copper and cadmium-type heavy metal transporting P-type ATPases (TIGR01511 and TIGR01512) as well as those species which score ambiguously between both models. For more comments and references, see the files on TIGR01511 and 01512.


Pssm-ID: 273669 [Multi-domain]  Cd Length: 558  Bit Score: 125.05  E-value: 5.18e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   251 YYWYALCIFLISAISICLALYKTRKQSLTLRDMVKLS-VRVQVCRPGGEEEWVDSSELVPGDCL-VLPqeGGVMPCDAAL 328
Cdd:TIGR01525   17 LVLEGALLLFLFLLGETLEERAKSRASDALSALLALApSTARVLQGDGSEEEVPVEELQVGDIViVRP--GERIPVDGVV 94
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   329 VAGECVVNESSLTGESTPVLKTalpegpkpycpethRRHTLFCGTLILQARAYVgprvlaVVTRTGFCTAKGGLVSSI-- 406
Cdd:TIGR01525   95 ISGESEVDESALTGESMPVEKK--------------EGDEVFAGTINGDGSLTI------RVTKLGEDSTLAQIVELVee 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   407 --LHPRPISFKFYKHSMKFVAALSVLALLGTVYSIIILYrnrvPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLR 484
Cdd:TIGR01525  155 aqSSKAPIQRLADRIASYYVPAVLAIALLTFVVWLALGA----LWREALYRALTVLVVACPCALGLATPVAILVAIGAAA 230
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   485 TQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLKGQVLLplvpepchlplgpLLRALATCHALSQLHdtPV 564
Cdd:TIGR01525  231 RRGILIKGGDALEKLAKVKTVVFDKTGTLTTGKPTVVDIEPLDDASEE-------------ELLALAAALEQSSSH--PL 295
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   565 G----DPMDLKMVESTGWVLEEGPAAGsapgsqvlvvmrpppggprqqeeppvpVSVLCrfpfssalqrmdvvvtwpgAT 640
Cdd:TIGR01525  296 AraivRYAKERGLELPPEDVEEVPGKG---------------------------VEATV-------------------DG 329
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   641 QPEAYVkGSPELVASLCSPETVPSDFSQVLQSYTAAGYRVVALAgkplpiapslaaaqqltrdtveRELSLLGLLVMRNL 720
Cdd:TIGR01525  330 GREVRI-GNPRFLGNRELAIEPISASPDLLNEGESQGKTVVFVA----------------------VDGELLGVIALRDQ 386
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   721 LKPQTAPVIQTLRKTG-IRTVMVTGDNLQTAVTVARACGmvgaqehlavihathpeqgqpaalefLPTEssavmngakat 799
Cdd:TIGR01525  387 LRPEAKEAIAALKRAGgIKLVMLTGDNRSAAEAVAAELG--------------------------IDDE----------- 429
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   800 gyptvpepqschlalsgstfavlrkhfpkllpkvlvqatVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAAD 879
Cdd:TIGR01525  430 ---------------------------------------VHAELLPEDKLAIVKKLQEEGGPVAMVGDGINDAPALAAAD 470

                   ....*.
gi 256985106   880 VGISLS 885
Cdd:TIGR01525  471 VGIAMG 476
ATPase-IIIA_H TIGR01647
plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton ...
283-1085 2.14e-29

plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton efflux P-type ATPase found in plants, fungi, protozoa, slime molds and archaea. The best studied representative is from yeast.


Pssm-ID: 273731 [Multi-domain]  Cd Length: 754  Bit Score: 124.75  E-value: 2.14e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   283 MVKLSVRVQVCRPGgeeEWV--DSSELVPGDCLVLpQEGGVMPCDAALVAGECV-VNESSLTGESTPVLKtalpegpkpy 359
Cdd:TIGR01647   87 KQSLAPKARVLRDG---KWQeiPASELVPGDVVRL-KIGDIVPADCRLFEGDYIqVDQAALTGESLPVTK---------- 152
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   360 cpetHRRHTLFCGTLILQARAyvgprvLAVVTRTGFCTAKG---GLVSSIlhpRPISFKFYKHSMKFVAALSVLALLGTV 436
Cdd:TIGR01647  153 ----KTGDIAYSGSTVKQGEA------EAVVTATGMNTFFGkaaALVQST---ETGSGHLQKILSKIGLFLIVLIGVLVL 219
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   437 YSIIILYRNRV-PVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTE 515
Cdd:TIGR01647  220 IELVVLFFGRGeSFREGLQFALVLLVGGIPIAMPAVLSVTMAVGAAELAKKKAIVTRLTAIEELAGMDILCSDKTGTLTL 299
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   516 DGLDVMGVVPLKGQVllplVPEPChlplgPLLRALATchalsqlhDTPVGDPMDLKMVESTgwvLEEGPAAGSapgsqvl 595
Cdd:TIGR01647  300 NKLSIDEILPFFNGF----DKDDV-----LLYAALAS--------REEDQDAIDTAVLGSA---KDLKEARDG------- 352
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   596 vvmrpppggprqqeeppvpVSVLCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLC-SPETVPSDFSQVLQSYT 674
Cdd:TIGR01647  353 -------------------YKVLEFVPFDPVDKRTEATVEDPETGKRFKVTKGAPQVILDLCdNKKEIEEKVEEKVDELA 413
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   675 AAGYRVVALAgkplpiapslaaaqqltRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVA 754
Cdd:TIGR01647  414 SRGYRALGVA-----------------RTDEEGRWHFLGLLPLFDPPRHDTKETIERARHLGVEVKMVTGDHLAIAKETA 476
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   755 RACGMvgaqehlavihathpeqgqpaaleflptessavmnGAKATGYPTVPEpqschlalsgstfAVLRKHFPKLLPKVL 834
Cdd:TIGR01647  477 RRLGL-----------------------------------GTNIYTADVLLK-------------GDNRDDLPSGLGEMV 508
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   835 VQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAE------ASVVspFTSSMASIecVPTV 908
Cdd:TIGR01647  509 EDADGFAEVFPEHKYEIVEILQKRGHLVGMTGDGVNDAPALKKADVGIAVAGATdaarsaADIV--LTEPGLSV--IVDA 584
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   909 IREGRcsldtsfSVFKYM---ALYSLTQFISVLILYTINTNLGDLQFLAIDLVItttVAVLmsRTGPALTLVRARPPGAL 985
Cdd:TIGR01647  585 ILESR-------KIFQRMksyVIYRIAETIRIVFFFGLLILILNFYFPPIMVVI---IAIL--NDGTIMTIAYDNVKPSK 652
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   986 LsvPVLGSL--LLQVALVAGI-----QLGGYFLVIAQPWFVPLNRTVPAPDNLpnyeNTVVF---SLSGFqyLILAAAVS 1055
Cdd:TIGR01647  653 L--PQRWNLreVFTMSTVLGIylvisTFLLLAIALDTTFFIDKFGLQLLHGNL----QSFIYlqvSISGH--ATIFVTRT 724
                          810       820       830
                   ....*....|....*....|....*....|.
gi 256985106  1056 KGapfrqPLYTNVP-FLVALALLGSVLVGLI 1085
Cdd:TIGR01647  725 HG-----FFWSERPgKLLFGAFVIAQIIATF 750
ATPase-IIA1_Ca TIGR01116
sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the ...
297-949 6.93e-28

sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the endoplasmic reticulum membrane of eukaryotes, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. These pumps transfer Ca2+ from the cytoplasm to the lumen of the endoplasmic reticulum. In humans and mice, at least, there are multiple isoforms of the SERCA pump with overlapping but not redundant functions. Defects in SERCA isoforms are associated with diseases in humans. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the latter of which is modelled by TIGR01522. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273452 [Multi-domain]  Cd Length: 917  Bit Score: 120.66  E-value: 6.93e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   297 GEEEWVDSSELVPGDCLVLPQeGGVMPCDAALVAGECV-VNESSLTGESTPVLKTALPEgPKPYCPETHRRHTLFCGTLI 375
Cdd:TIGR01116   81 GRWSVIKAKDLVPGDIVELAV-GDKVPADIRVLSLKTLrVDQSILTGESVSVNKHTESV-PDERAVNQDKKNMLFSGTLV 158
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   376 LQARAyvgprvLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMKFVAALS-VLALLGT-VYSIIILYRNRVPVREIV 453
Cdd:TIGR01116  159 VAGKA------RGVVVRTGMSTEIGKIRDEMRAAEQEDTPLQKKLDEFGELLSkVIGLICIlVWVINIGHFNDPALGGGW 232
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   454 IR--------ALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVP 525
Cdd:TIGR01116  233 IQgaiyyfkiAVALAVAAIPEGLPAVITTCLALGTRKMAKKNAIVRKLPSVETLGCTTVICSDKTGTLTTNQMSVCKVVA 312
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   526 LKGQ-------------------VLLPLVPEPCHLPlgPLLRALATCHALSqlhdtpvgDPMDLKMVESTGWVLEEGPAA 586
Cdd:TIGR01116  313 LDPSssslnefcvtgttyapeggVIKDDGPVAGGQD--AGLEELATIAALC--------NDSSLDFNERKGVYEKVGEAT 382
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   587 GSApgSQVLVVMRPPPGGPRQQEEPPVPVSVLCRF-----------PFSSALQRMDVVVTwpGATQPEAYVKGSPELVAS 655
Cdd:TIGR01116  383 EAA--LKVLVEKMGLPATKNGVSSKRRPALGCNSVwndkfkklatlEFSRDRKSMSVLCK--PSTGNKLFVKGAPEGVLE 458
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   656 LCS----------PETvPSDFSQVLQSY----TAAGYRVVALAGKPLPIAPSLAAAQQLTR-DTVERELSLLGLLVMRNL 720
Cdd:TIGR01116  459 RCThilngdgravPLT-DKMKNTILSVIkemgTTKALRCLALAFKDIPDPREEDLLSDPANfEAIESDLTFIGVVGMLDP 537
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   721 LKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVGAQEHLAVIHATHPEQGQPAALEFLPTESSAVmngakatg 800
Cdd:TIGR01116  538 PRPEVADAIEKCRTAGIRVIMITGDNKETAEAICRRIGIFSPDEDVTFKSFTGREFDEMGPAKQRAACRSAV-------- 609
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   801 yptvpepqschlalsgstfavlrkhfpkllpkvlvqatVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADV 880
Cdd:TIGR01116  610 --------------------------------------LFSRVEPSHKSELVELLQEQGEIVAMTGDGVNDAPALKKADI 651
                          650       660       670       680       690       700       710
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 256985106   881 GISLSQAEAsvVSPFTSSMA----SIECVPTVIREGRcsldtsfSVFKYMalyslTQFISvlilYTINTNLGD 949
Cdd:TIGR01116  652 GIAMGSGTE--VAKEASDMVladdNFATIVAAVEEGR-------AIYNNM-----KQFIR----YMISSNIGE 706
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
179-887 1.47e-26

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 116.32  E-value: 1.47e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  179 QVSLLDHGRTCDDVHCSSSGLSLQDQATRKTIYGPNVISI--PVKSYLQLLaDEALNPyygfqaFSIALWLADHYYWY-- 254
Cdd:PRK10517   48 KAAVMPEEELWKTFDTHPEGLNEAEVESAREQHGENELPAqkPLPWWVHLW-VCYRNP------FNILLTILGAISYAte 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  255 ----ALCIFLISAISICLALY---KTRKQSLTLRDMVKLSVRVQVCRPG-GEEEWVDS--SELVPGDCLVLpQEGGVMPC 324
Cdd:PRK10517  121 dlfaAGVIALMVAISTLLNFIqeaRSTKAADALKAMVSNTATVLRVINDkGENGWLEIpiDQLVPGDIIKL-AAGDMIPA 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  325 DA-ALVAGECVVNESSLTGESTPVLKTALPEGPKPYCPethrrhtLFCGTLILQARAYVGPRVLAVVTRTGFCTAKGGLV 403
Cdd:PRK10517  200 DLrILQARDLFVAQASLTGESLPVEKFATTRQPEHSNP-------LECDTLCFMGTNVVSGTAQAVVIATGANTWFGQLA 272
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  404 SSILHP--RPISFKF--YKHSMKFVAALSVLAllgtvysIIILYRN---RVPVREIVIRALDLVTVVVPPALPaaMTVCT 476
Cdd:PRK10517  273 GRVSEQdsEPNAFQQgiSRVSWLLIRFMLVMA-------PVVLLINgytKGDWWEAALFALSVAVGLTPEMLP--MIVTS 343
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  477 LYAQS--RLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGL------DVMGvvplkgqvllplvpEPCHlplGPLLR 548
Cdd:PRK10517  344 TLARGavKLSKQKVIVKRLDAIQNFGAMDILCTDKTGTLTQDKIvlenhtDISG--------------KTSE---RVLHS 406
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  549 ALATCH---ALSQLHDTPVGDPMDL--KMVESTGWvleegpaagsapgsqvlvvmrpppggpRQQEEppvpvsvlcrFPF 623
Cdd:PRK10517  407 AWLNSHyqtGLKNLLDTAVLEGVDEesARSLASRW---------------------------QKIDE----------IPF 449
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  624 SSALQRMDVVVTWPGAtQPEAYVKGSPELVASLCS-----PETVPSDFS------QVLQSYTAAGYRVVALAGKPLPiap 692
Cdd:PRK10517  450 DFERRRMSVVVAENTE-HHQLICKGALEEILNVCSqvrhnGEIVPLDDImlrrikRVTDTLNRQGLRVVAVATKYLP--- 525
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  693 slaAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAvtvARACGMVGAqEHLAVIHAT 772
Cdd:PRK10517  526 ---AREGDYQRADESDLILEGYIAFLDPPKETTAPALKALKASGVTVKILTGDSELVA---AKVCHEVGL-DAGEVLIGS 598
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  773 HPEQgqpaaleflptessavMNGAKatgyptvpepqschlalsgstfavlrkhfpklLPKVLVQATVFARMAPEQKTELV 852
Cdd:PRK10517  599 DIET----------------LSDDE--------------------------------LANLAERTTLFARLTPMHKERIV 630
                         730       740       750
                  ....*....|....*....|....*....|....*
gi 256985106  853 CELQRLQYCVGMCGDGANDCGALKAADVGISLSQA 887
Cdd:PRK10517  631 TLLKREGHVVGFMGDGINDAPALRAADIGISVDGA 665
ZntA COG2217
Cation transport ATPase [Inorganic ion transport and metabolism];
240-883 4.37e-24

Cation transport ATPase [Inorganic ion transport and metabolism];


Pssm-ID: 225127 [Multi-domain]  Cd Length: 713  Bit Score: 107.68  E-value: 4.37e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  240 AFSIALWLADHYYWY-ALCIFLISaISICLALYKTRKQSLTLRDMVKLSVR-VQVCRPGGEEEWVDSSELVPGDCLVLPQ 317
Cdd:COG2217   162 AYSLYATLFPVYFEEaAMLIFLFL-LGRYLEARAKGRARRAIRALLDLAPKtATVVRGDGEEEEVPVEEVQVGDIVLVRP 240
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  318 eGGVMPCDAALVAGECVVNESSLTGESTPVLKTalpEGpkpycpethrrHTLFCGTLILQArayvgpRVLAVVTRTGFCT 397
Cdd:COG2217   241 -GERIPVDGVVVSGSSSVDESMLTGESLPVEKK---PG-----------DEVFAGTVNLDG------SLTIRVTRVGADT 299
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  398 AKGGLVSSI----LHPRPISFKFYKHSMKFVAALSVLALLGTVYSIIILyrnRVPVREIVIRALDLVTVVVPPAL----P 469
Cdd:COG2217   300 TLARIIRLVeeaqSSKAPIQRLADRVASYFVPVVLVIAALTFALWPLFG---GGDWETALYRALAVLVIACPCALglatP 376
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  470 AAMTVctlyAQSRLRTQGIFcihplrINLG------GKLRLVCFDKTGTLTEDGLDVMGVVPLKGQVLLplvpepchlpl 543
Cdd:COG2217   377 TAILV----GIGRAARRGIL------IKGGealerlAKVDTVVFDKTGTLTEGKPEVTDVVALDGDEDE----------- 435
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  544 gpLLRALAtchALSQLHDTPVGDPmdlkmvestgwVLEEGPAAGSAPGSQVLVVmrppPGgprqqeeppvpvsvlcrfpf 623
Cdd:COG2217   436 --LLALAA---ALEQHSEHPLAKA-----------IVKAAAERGLPDVEDFEEI----PG-------------------- 475
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  624 ssalqrMDVVVTWPGATqpeaYVKGSPELVASLCSPETVPSDFSQVLQSytaAGYRVVALA--GKplpiapslaaaqqlt 701
Cdd:COG2217   476 ------RGVEAEVDGER----VLVGNARLLGEEGIDLPLLSERIEALES---EGKTVVFVAvdGK--------------- 527
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  702 rdtverelsLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMvgaqehlavihathpeqgqpaa 781
Cdd:COG2217   528 ---------LVGVIALADELRPDAKEAIAALKALGIKVVMLTGDNRRTAEAIAKELGI---------------------- 576
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  782 leflptessavmngakatgyptvpepqschlalsgstfavlrkhfpkllpkvlvqATVFARMAPEQKTELVCELQRLQYC 861
Cdd:COG2217   577 -------------------------------------------------------DEVRAELLPEDKAEIVRELQAEGRK 601
                         650       660
                  ....*....|....*....|..
gi 256985106  862 VGMCGDGANDCGALKAADVGIS 883
Cdd:COG2217   602 VAMVGDGINDAPALAAADVGIA 623
ATPase-IB2_Cd TIGR01512
heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; This model describes the P-type ...
247-893 4.75e-24

heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; This model describes the P-type ATPase primarily responsible for translocating cadmium ions (and other closely-related divalent heavy metals such as cobalt, mercury, lead and zinc) across biological membranes. These transporters are found in prokaryotes and plants. Experimentally characterized members of the seed alignment include: SP|P37617 from E. coli, SP|Q10866 from Mycobacterium tuberculosis and SP|Q59998 from Synechocystis PCC6803. The cadmium P-type ATPases have been characterized as Type IB based on a phylogenetic analysis which combines the copper-translocating ATPases with the cadmium-translocating species. This model and that describing the copper-ATPases (TIGR01511) are well separated, and thus we further type the copper-ATPases as IB1 and the cadmium-ATPases as IB2. Several sequences which have not been characterized experimentally fall just below trusted cutoff for both of these models (SP|Q9CCL1 from Mycobacterium leprae, GP|13816263 from Sulfolobus solfataricus, OMNI|NTL01CJ01098 from Campylobacter jejuni, OMNI|NTL01HS01687 from Halobacterium sp., GP|6899169 from Ureaplasma urealyticum and OMNI|HP1503 from Helicobacter pylori). [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273665 [Multi-domain]  Cd Length: 550  Bit Score: 106.64  E-value: 4.75e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   247 LADHYYWYALCIFLISAISICLALYKTRKQSLTLRDMVKLSVRVQVCRPGGEEEWVDSSELVPGDcLVLPQEGGVMPCDA 326
Cdd:TIGR01512   13 VAIGEYLEGALLLLLFSIGETLEEYASGRARRALKALMELAPDTARRLQGDSLEEVAVEELKVGD-VVVVKPGERVPVDG 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   327 ALVAGECVVNESSLTGESTPVLKTalpegpkpycpethRRHTLFCGTLILQARAYVgprvlaVVTRTGFCTAKGGLVSSI 406
Cdd:TIGR01512   92 EVLSGTSSVDESALTGESVPVEKA--------------PGDEVFAGAINLDGVLTI------EVTKLPADSTIAKIVNLV 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   407 LHPRPISFKFYKHSMKFVAALSVLALLGTVYSIIILYR-NRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRT 485
Cdd:TIGR01512  152 EEAQSRKAPTQRFIDRFARYYTPAVLAIALAAALVPPLlGAGPFLEWIYRALVLLVVASPCALVISAPAAYLSAISAAAR 231
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   486 QGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLKGQVLlplvpepchlplgPLLRALATCHALSQLHdtpvg 565
Cdd:TIGR01512  232 HGILIKGGAALEALAKIKTVAFDKTGTLTTGKPKVTDVHPADGHSE-------------SEVLRLAAAAEQGSTH----- 293
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   566 dPMDLKMVESTgwvleegpaagsapgsqvlvvmrpppggprQQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQpeay 645
Cdd:TIGR01512  294 -PLARAIVDYA------------------------------RARELAPPVEDVEEVPGEGVRAVVDGGEVRIGNPR---- 338
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   646 vKGSPELVASLCSPETVPSDFSqvlqsytaagyrVVALAGKplpiapslaaaqqltrdtverelsLLGLLVMRNLLKPQT 725
Cdd:TIGR01512  339 -SLSEAVGASIAVPESAGKTIV------------LVARDGT------------------------LLGYIALSDELRPDA 381
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   726 APVIQTLRKTGI-RTVMVTGDNLQTAVTVARAcgmVGAQEhlavihathpeqgqpaaleflptessavmngakatgyptv 804
Cdd:TIGR01512  382 AEAIAELKALGIkRLVMLTGDRRAVAEAVARE---LGIDE---------------------------------------- 418
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   805 pepqschlalsgstfavlrkhfpkllpkvlvqatVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISL 884
Cdd:TIGR01512  419 ----------------------------------VHAELLPEDKLEIVKELREKAGPVAMVGDGINDAPALAAADVGIAM 464

                   ....*....
gi 256985106   885 SQAEASVVS 893
Cdd:TIGR01512  465 GASGSDVAL 473
ATPase-IIC_X-K TIGR01106
sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This ...
179-1022 4.76e-23

sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This model describes the P-type ATPases responsible for the exchange of either protons or sodium ions for potassium ions across the plasma membranes of eukaryotes. Unlike most other P-type ATPases, members of this subfamily require a beta subunit for activity. This model encompasses eukaryotes and consists of two functional types, a Na/K antiporter found widely distributed in eukaryotes and a H/K antiporter found only in vertebrates. The Na+ or H+/K+ antiporter P-type ATPases have been characterized as Type IIC based on a published phylogenetic analysis. Sequences from Blastocladiella emersonii (GP|6636502, GP|6636502 and PIR|T43025), C. elegans (GP|2315419, GP|6671808 and PIR|T31763) and Drosophila melanogaster (GP|7291424) score below trusted cutoff, apparently due to long branch length (excessive divergence from the last common ancestor) as evidenced by a phylogenetic tree. Experimental evidence is needed to determine whether these sequences represent ATPases with conserved function. Aside from fragments, other sequences between trusted and noise appear to be bacterial ATPases of unclear lineage, but most likely calcium pumps. [Energy metabolism, ATP-proton motive force interconversion]


Pssm-ID: 273445 [Multi-domain]  Cd Length: 997  Bit Score: 104.87  E-value: 4.76e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   179 QVSLLDHGRTCDDVHCS-----SSGLSLQDQATRKTIYGPNVISIP------VKSYLQLladealnpyygFQAFSIALWL 247
Cdd:TIGR01106   12 EVEMDDHKLSLDELERKygtdlSKGLSAARAAEILARDGPNALTPPpttpewVKFCRQL-----------FGGFSMLLWI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   248 ADHYYWYALCI----------------FLISAISI---CLALYKTRKQSLTLRDMVKLSVRVQVCRPGGEEEWVDSSELV 308
Cdd:TIGR01106   81 GAILCFLAYGIqasteeepqndnlylgVVLSAVVIitgCFSYYQEAKSSKIMESFKNMVPQQALVIRDGEKMSINAEQVV 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   309 PGDcLVLPQEGGVMPCDAALVAGE-CVVNESSLTGESTPvlKTALPEGPKPYCPEThrRHTLFCGTLILQARAyvgprvL 387
Cdd:TIGR01106  161 VGD-LVEVKGGDRIPADLRIISAQgCKVDNSSLTGESEP--QTRSPEFTHENPLET--RNIAFFSTNCVEGTA------R 229
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   388 AVVTRTGFCTAKG---GLVSSILHPR-PISFKFyKHSMKFVAALSV-LALLGTVYSIIILYRnrvpVREIVIRALDLVTV 462
Cdd:TIGR01106  230 GIVVNTGDRTVMGriaSLASGLENGKtPIAIEI-EHFIHIITGVAVfLGVSFFILSLILGYT----WLEAVIFLIGIIVA 304
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   463 VVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVpLKGQVLLPLVPE----P 538
Cdd:TIGR01106  305 NVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW-FDNQIHEADTTEdqsgV 383
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   539 CHLPLGPLLRALATCHALSQLHDTPVGD---PMDLKMVestgwvleegpaAGSAPGSQVLVVMRPPPGGPRQQEEPPVPV 615
Cdd:TIGR01106  384 SFDKSSATWLALSRIAGLCNRAVFKAGQenvPILKRAV------------AGDASESALLKCIELCLGSVMEMRERNPKV 451
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   616 svlCRFPFSSALQRMDVVVTWPGATQPE--AYVKGSPELVASLCSP-----ETVPSDfSQVLQSYTAA-------GYRVV 681
Cdd:TIGR01106  452 ---VEIPFNSTNKYQLSIHENEDPRDPRhlLVMKGAPERILERCSSilihgKEQPLD-EELKEAFQNAylelgglGERVL 527
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   682 ALAGKPLPiAPSLAAAQQLTRDTVE---RELSLLGLLVMrnlLKPQTAPV---IQTLRKTGIRTVMVTGDNLQTAVTVAR 755
Cdd:TIGR01106  528 GFCHLYLP-DEQFPEGFQFDTDDVNfptDNLCFVGLISM---IDPPRAAVpdaVGKCRSAGIKVIMVTGDHPITAKAIAK 603
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   756 ACGMVGA----QEHLAVIHATHPEQGQPAaleflpTESSAVMNGAKatgyptvpepqschlalsgstfavLRKHFPKLLP 831
Cdd:TIGR01106  604 GVGIISEgnetVEDIAARLNIPVSQVNPR------DAKACVVHGSD------------------------LKDMTSEQLD 653
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   832 KVLVQAT--VFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAeASVVSPFTSSM-------ASI 902
Cdd:TIGR01106  654 EILKYHTeiVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIA-GSDVSKQAADMillddnfASI 732
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   903 ecvPTVIREGRCSLDTsfsvFKYMALYSLTQFIS------VLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTL 976
Cdd:TIGR01106  733 ---VTGVEEGRLIFDN----LKKSIAYTLTSNIPeitpflIFIIANIPLPLGTITILCIDLGTDMVPAISLAYEKAESDI 805
                          890       900       910       920       930
                   ....*....|....*....|....*....|....*....|....*....|...
gi 256985106   977 VRARPPGA----LLSVPVLGSLLLQVALVAGiqLGG---YFLVIAQPWFVPLN 1022
Cdd:TIGR01106  806 MKRQPRNPktdkLVNERLISMAYGQIGMIQA--LGGfftYFVILAENGFLPLH 856
ATPase-IB1_Cu TIGR01511
copper-(or silver)-translocating P-type ATPase; This model describes the P-type ATPase ...
246-885 4.89e-21

copper-(or silver)-translocating P-type ATPase; This model describes the P-type ATPase primarily responsible for translocating copper ions accross biological membranes. These transporters are found in prokaryotes and eukaryotes. This model encompasses those species which pump copper ions out of cells or organelles (efflux pumps such as CopA of Escherichia coli) as well as those which pump the ion into cells or organelles either for the purpose of supporting life in extremely low-copper environments (for example CopA of Enterococcus hirae) or for the specific delivery of copper to a biological complex for which it is a necessary component (for example FixI of Bradyrhizobium japonicum, or CtaA and PacS of Synechocystis). The substrate specificity of these transporters may, to a varying degree, include silver ions (for example, CopA from Archaeoglobus fulgidus). Copper transporters from this family are well known as the genes which are mutated in two human disorders of copper metabolism, Wilson's and Menkes' diseases. The sequences contributing to the seed of this model are all experimentally characterized. The copper P-type ATPases have been characterized as Type IB based on a phylogenetic analysis which combines the copper-translocating ATPases with the cadmium-translocating species. This model and that describing the cadmium-ATPases (TIGR01512) are well separated, and thus we further type the copper-ATPases as IB1 (and the cadmium-ATPases as IB2). Several sequences which have not been characterized experimentally fall just below the cutoffs for both of these models (SP|Q9CCL1 from Mycobacterium leprae, GP|13816263 from Sulfolobus solfataricus, OMNI|NTL01CJ01098 from Campylobacter jejuni, OMNI|NTL01HS01687 from Halobacterium sp., GP|6899169 from Ureaplasma urealyticum and OMNI|HP1503 from Helicobacter pylori). Accession PIR|A29576 from Enterococcus faecalis scores very high against this model, but yet is annotated as an "H+/K+ exchanging ATPase". BLAST of this sequence does not hit anything else annotated in this way. This error may come from the characterization paper published in 1987. Accession GP|7415611 from Saccharomyces cerevisiae appears to be mis-annotated as a cadmium resistance protein. Accession OMNI|NTL01HS00542 from Halobacterium which scores above trusted for this model is annotated as "molybdenum-binding protein" although no evidence can be found for this classification. [Cellular processes, Detoxification, Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273664 [Multi-domain]  Cd Length: 562  Bit Score: 97.35  E-value: 4.89e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   246 WLADHYYWYALCiFLISAISI-----CLALYKTRKqslTLRDMVKLSVR-VQVCRPGGEEEWVDSSELVPGDCL-VLPqe 318
Cdd:TIGR01511   47 GLHVHTFFDASA-MLITFILLgrwleMLAKGRASD---ALSKLAKLQPStATLLTKDGSIEEVPVALLQPGDIVkVLP-- 120
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   319 GGVMPCDAALVAGECVVNESSLTGESTPVLKTalpEGpkpycpethrrHTLFCGTLilqarayVGPRVLAV-VTRTGFCT 397
Cdd:TIGR01511  121 GEKIPVDGTVIEGESEVDESLVTGESLPVPKK---VG-----------DPVIAGTV-------NGTGSLVVrATATGEDT 179
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   398 -----------AKGG---------LVSSILHPrpisfkfykhsmkFVAALSVLALLGTVYSIIILyrnrvpvreiviral 457
Cdd:TIGR01511  180 tlaqivrlvrqAQQSkapiqrladKVAGYFVP-------------VVIAIALITFVIWLFALEFA--------------- 231
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   458 dlVTVVV---PPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVvplkgqvllpl 534
Cdd:TIGR01511  232 --VTVLIiacPCALGLATPTVIAVATGLAAKNGVLIKDGDALERAANIDTVVFDKTGTLTQGKPTVTDV----------- 298
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   535 vpepchLPLGPLLR--ALATCHALSQLHDTPVGdpmdlkmVESTGWVLEEGPAAGSAPGSQVLvvmrppPGgprqqeepp 612
Cdd:TIGR01511  299 ------HVFGDRDRteLLALAAALEAGSEHPLA-------KAIVSYAKEKGITLVTVSDFKAI------PG--------- 350
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   613 vpvsvlcrfpfssalqrmdVVVTwpGATQPEAYVKGSPELVaslcspetvpsdfsqvlqsytaagyrvvalagKPLPIAP 692
Cdd:TIGR01511  351 -------------------IGVE--GTVEGTKIQLGNEKLL--------------------------------GENAIKI 377
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   693 SLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMvgaqehlavihat 772
Cdd:TIGR01511  378 DGKAGQGSTVVLVAVNGELAGVFALEDQLRPEAKEVIQALKRRGIEPVMLTGDNRKTAKAVAKELGI------------- 444
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   773 hpeqgqpaaleflptessavmngakatgyptvpepqschlalsgstfavlrkhfpkllpkvlvqaTVFARMAPEQKTELV 852
Cdd:TIGR01511  445 -----------------------------------------------------------------DVRAEVLPDDKAALI 459
                          650       660       670
                   ....*....|....*....|....*....|...
gi 256985106   853 CELQRLQYCVGMCGDGANDCGALKAADVGISLS 885
Cdd:TIGR01511  460 KKLQEKGPVVAMVGDGINDAPALAQADVGIAIG 492
PRK15122 PRK15122
magnesium-transporting ATPase; Provisional
192-883 3.67e-19

magnesium-transporting ATPase; Provisional


Pssm-ID: 237914 [Multi-domain]  Cd Length: 903  Bit Score: 92.40  E-value: 3.67e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  192 VHCSSSGLSLQDQATRKTIYGPNVIS--IPVKSYLQLLAdeAL-NPY-YGFQAFSIALWLADhyYWYAL----------C 257
Cdd:PRK15122   39 LNTHRQGLTEEDAAERLQRYGPNEVAheKPPHALVQLLQ--AFnNPFiYVLMVLAAISFFTD--YWLPLrrgeetdltgV 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  258 IFLISAISICLAL-----YKTRKQSLTLRDMVKLSV----RVQVCRPGGEEEwVDSSELVPGDCLVLpQEGGVMPCDAAL 328
Cdd:PRK15122  115 IIILTMVLLSGLLrfwqeFRSNKAAEALKAMVRTTAtvlrRGHAGAEPVRRE-IPMRELVPGDIVHL-SAGDMIPADVRL 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  329 VAG-ECVVNESSLTGESTPVLK---TALPEGPKPYCPETHRRHTL------FCGTLILQARAyvgprvLAVVTRTGFCTA 398
Cdd:PRK15122  193 IESrDLFISQAVLTGEALPVEKydtLGAVAGKSADALADDEGSLLdlpnicFMGTNVVSGTA------TAVVVATGSRTY 266
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  399 KGGLVSSILHPRP-ISFKfykhsmKFVAALSVLallgtvysIIILYRNRVPV------------REIVIRALDLVTVVVP 465
Cdd:PRK15122  267 FGSLAKSIVGTRAqTAFD------RGVNSVSWL--------LIRFMLVMVPVvllingftkgdwLEALLFALAVAVGLTP 332
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  466 PALPaaMTVCTLYAQ------------SRLRTQGIFcihplrinlgGKLRLVCFDKTGTLTEDG------LDVMGVVPLK 527
Cdd:PRK15122  333 EMLP--MIVSSNLAKgaiamarrkvvvKRLNAIQNF----------GAMDVLCTDKTGTLTQDRiilehhLDVSGRKDER 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  528 gqVLlplvpepchlplgpllrALATchaLSQLHDTPVGDPMDLKMVEStgwvleegpaAGSAPGSQvlvvmrpPPGGPRQ 607
Cdd:PRK15122  401 --VL-----------------QLAW---LNSFHQSGMKNLMDQAVVAF----------AEGNPEIV-------KPAGYRK 441
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  608 QEEppvpvsvlcrFPFSSALQRMDVVVTWPGATQpEAYVKGSPELVASLCS-----PETVPSDFS---QVLQ---SYTAA 676
Cdd:PRK15122  442 VDE----------LPFDFVRRRLSVVVEDAQGQH-LLICKGAVEEMLAVAThvrdgDTVRPLDEArreRLLAlaeAYNAD 510
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  677 GYRVVALAGKPLPIAPSlaaAQQLTRDTvERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNlqtAVTVARA 756
Cdd:PRK15122  511 GFRVLLVATREIPGGES---RAQYSTAD-ERDLVIRGFLTFLDPPKESAAPAIAALRENGVAVKVLTGDN---PIVTAKI 583
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  757 CGMVGAqehlavihathpEQGQPaaleflptessavmngakatgyptvpepqschlaLSGSTFAVLRKhfpKLLPKVLVQ 836
Cdd:PRK15122  584 CREVGL------------EPGEP----------------------------------LLGTEIEAMDD---AALAREVEE 614
                         730       740       750       760
                  ....*....|....*....|....*....|....*....|....*..
gi 256985106  837 ATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGIS 883
Cdd:PRK15122  615 RTVFAKLTPLQKSRVLKALQANGHTVGFLGDGINDAPALRDADVGIS 661
ATPase-Plipid TIGR01652
phospholipid-translocating P-type ATPase, flippase; This model describes the P-type ATPase ...
617-895 6.66e-14

phospholipid-translocating P-type ATPase, flippase; This model describes the P-type ATPase responsible for transporting phospholipids from one leaflet of bilayer membranes to the other. These ATPases are found only in eukaryotes.


Pssm-ID: 273734 [Multi-domain]  Cd Length: 1057  Bit Score: 75.11  E-value: 6.66e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   617 VLCRFPFSSALQRMDVVVTWPGAtQPEAYVKGSPELVASLCS--PETVPSDFSQVLQSYTAAGYRVVALAGKPLP----- 689
Cdd:TIGR01652  511 ILNVLEFNSDRKRMSVIVRNPDG-RIKLLCKGADTVIFKRLSsgGNQVNEETKEHLENYASEGLRTLCIAYRELSeeeye 589
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   690 --------IAPSLAAAQQLTR---DTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACG 758
Cdd:TIGR01652  590 ewneeyneASTALTDREEKLDvvaESIEKDLILLGATAIEDKLQEGVPETIELLRQAGIKIWVLTGDKVETAINIGYSCR 669
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   759 MVGAQEHLAVIHATH--PEQGQPAALEFLPTESSAVMNGAKATG-YPTVPEPQSCHLALSGStfavLRKHFpkLLPKVLV 835
Cdd:TIGR01652  670 LLSRNMEQIVITSDSldATRSVEAAIKFGLEGTSEEFNNLGDSGnVALVIDGKSLGYALDEE----LEKEF--LQLALKC 743
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 256985106   836 QATVFARMAPEQKTELVC----ELQRLQYCVgmcGDGANDCGALKAADVGISLSQAE---ASVVSPF 895
Cdd:TIGR01652  744 KAVICCRVSPSQKADVVRlvkkSTGKTTLAI---GDGANDVSMIQEADVGVGISGKEgmqAVMASDF 807
KdpB COG2216
High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism];
240-928 9.79e-12

High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism];


Pssm-ID: 225126 [Multi-domain]  Cd Length: 681  Bit Score: 67.68  E-value: 9.79e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  240 AFSIALWLadhyyWYALcifLISAISICLALYKTRKQSLTLRdMVKLSVRVQVCRPGGEEEWVDSSELVPGDcLVLPQEG 319
Cdd:COG2216    65 NLAITIIL-----WFTV---LFANFAEAVAEGRGKAQADSLR-KTKTETIARLLRADGSIEMVPATELKKGD-IVLVEAG 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  320 GVMPCDAALVAGECVVNESSLTGESTPVLKTAlpegpkpycpethrrhtlfcGTlilqARAYV--GPRVLA--VVTRtgf 395
Cdd:COG2216   135 EIIPSDGEVIEGVASVDESAITGESAPVIRES--------------------GG----DFSSVtgGTRVLSdwLKIR--- 187
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  396 CTAKGGlvSSILH--------------PRPISFKFykhsmkFVAALSVLALLGTV--YSIIIlYRNRVPVREIVIRALdL 459
Cdd:COG2216   188 ITANPG--ETFLDrmialvegaerqktPNEIALTI------LLSGLTLIFLLAVAtlYPFAI-YSGGGAASVTVLVAL-L 257
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  460 VTvVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLKGQVllplvpepc 539
Cdd:COG2216   258 VC-LIPTTIGGLLSAIGIAGMDRVTQFNVIATSGRAVEAAGDVDTLLLDKTGTITLGNRQASEFIPVPGVS--------- 327
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  540 hlplgplLRALATCHALSQLHD-TPVGDPMdLKMVESTGWVLEEgpaagsapgsqvlvvmrpppggpRQQEEPPVPVsvl 618
Cdd:COG2216   328 -------EEELADAAQLASLADeTPEGRSI-VELAKKLGIELRE-----------------------DDLQSHAEFV--- 373
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  619 crfPFsSALQRMDvVVTWPGATQpeaYVKGSPELVASLCSPE--TVPSDFSQVLQsytaagyRVVALAGKPLPiapslaa 696
Cdd:COG2216   374 ---PF-TAQTRMS-GVDLPGGRE---IRKGAVDAIRRYVRERggHIPEDLDAAVD-------EVSRLGGTPLV------- 431
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  697 aqqltrdtVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVgaqehlavihathpeq 776
Cdd:COG2216   432 --------VVENGRILGVIYLKDIVKPGIKERFAELRKMGIKTVMITGDNPLTAAAIAAEAGVD---------------- 487
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  777 gqpaalEFLptessavmngAKATgyptvpepqschlalsgstfavlrkhfpkllpkvlvqatvfarmaPEQKTELVCELQ 856
Cdd:COG2216   488 ------DFI----------AEAT---------------------------------------------PEDKLALIRQEQ 506
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  857 RLQYCVGMCGDGANDCGALKAADVGISL---SQA--EAsvvspftSSMASIECVPT----VIREG------RCSLdTSFS 921
Cdd:COG2216   507 AEGRLVAMTGDGTNDAPALAQADVGVAMnsgTQAakEA-------ANMVDLDSNPTklieVVEIGkqllitRGAL-TTFS 578
                         730
                  ....*....|.
gi 256985106  922 ----VFKYMAL 928
Cdd:COG2216   579 iandVAKYFAI 589
PLN03190 PLN03190
aminophospholipid translocase; Provisional
500-945 2.71e-11

aminophospholipid translocase; Provisional


Pssm-ID: 215623 [Multi-domain]  Cd Length: 1178  Bit Score: 66.85  E-value: 2.71e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  500 GKLRLVCFDKTGTLTEDGLD-----VMGV-----------------VPLKGQVLLPLV-----PEPCHLP---------- 542
Cdd:PLN03190  451 GQIKYVFSDKTGTLTENKMEfqcasIWGVdysdgrtptqndhagysVEVDGKILRPKMkvkvdPQLLELSksgkdteeak 530
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  543 -LGPLLRALATCHALSQLHDTPVGDPmDLKMVESTGWVLEEGPAAGSAPGSQVLVVMRPPP------GGPRQQeeppvpV 615
Cdd:PLN03190  531 hVHDFFLALAACNTIVPIVVDDTSDP-TVKLMDYQGESPDEQALVYAAAAYGFMLIERTSGhividiHGERQR------F 603
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  616 SVLCRFPFSSALQRMDVVVTWPGATQpEAYVKGSPELVASL---CSPETVPSDFSQVLQSYTAAGYRVVALAGKPL---- 688
Cdd:PLN03190  604 NVLGLHEFDSDRKRMSVILGCPDKTV-KVFVKGADTSMFSVidrSLNMNVIRATEAHLHTYSSLGLRTLVVGMRELndse 682
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  689 ---------PIAPSLAAAQQLTR---DTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARA 756
Cdd:PLN03190  683 feqwhfsfeAASTALIGRAALLRkvaSNVENNLTILGASAIEDKLQQGVPEAIESLRTAGIKVWVLTGDKQETAISIGYS 762
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  757 CGMVGAQEHLAVIHATHPEQGQPAALEFLPTESS--AVMNGAKATGYPTVPEPQSCHLALSGSTFA-VLRKHFPKLLPKV 833
Cdd:PLN03190  763 SKLLTNKMTQIIINSNSKESCRKSLEDALVMSKKltTVSGISQNTGGSSAAASDPVALIIDGTSLVyVLDSELEEQLFQL 842
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  834 LVQATVF--ARMAPEQKTELVCELQ-RLQYCVGMCGDGANDCGALKAADVGISLSQAE---ASVVSPFtsSMASIE-CVP 906
Cdd:PLN03190  843 ASKCSVVlcCRVAPLQKAGIVALVKnRTSDMTLAIGDGANDVSMIQMADVGVGISGQEgrqAVMASDF--AMGQFRfLVP 920
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|..
gi 256985106  907 TVIREGRCsldtSFSVFKYMALYSLTQ---FISVLILYTINT 945
Cdd:PLN03190  921 LLLVHGHW----NYQRMGYMILYNFYRnavFVLVLFWYVLFT 958
zntA PRK11033
zinc/cadmium/mercury/lead-transporting ATPase; Provisional
296-759 1.45e-08

zinc/cadmium/mercury/lead-transporting ATPase; Provisional


Pssm-ID: 236827 [Multi-domain]  Cd Length: 741  Bit Score: 57.70  E-value: 1.45e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  296 GGEEEWVDSSELVPGDCL-VLPqeGGVMPCDAALVAGECVVNESSLTGESTPVLKTAlpeGPKpycpethrrhtlfcgtl 374
Cdd:PRK11033  250 DGEREEVAIADLRPGDVIeVAA--GGRLPADGKLLSPFASFDESALTGESIPVERAT---GEK----------------- 307
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  375 iLQARAYVGPRV--LAVVTRTGfctakGGLVSSILH--------PRPISFKFYKHSMKFVAALSVLALLGTVYSIIILYR 444
Cdd:PRK11033  308 -VPAGATSVDRLvtLEVLSEPG-----ASAIDRILHlieeaeerRAPIERFIDRFSRIYTPAIMLVALLVILVPPLLFAA 381
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  445 nrvPVREIVIRALDLVTVVVPPAL----PAAMTvCTLYAQSRlrtQGIFcihplrINLG------GKLRLVCFDKTGTLT 514
Cdd:PRK11033  382 ---PWQEWIYRGLTLLLIGCPCALvistPAAIT-SGLAAAAR---RGAL------IKGGaaleqlGRVTTVAFDKTGTLT 448
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  515 EDGLDVMGVVPLKGQVLLPLvpepchlplgpLLRALAtchalsqlhdtpvgdpmdlkmVEStgwvleegpaaGSA-PGSQ 593
Cdd:PRK11033  449 EGKPQVTDIHPATGISESEL-----------LALAAA---------------------VEQ-----------GSThPLAQ 485
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  594 VLVVMrpppggpRQQEEPPVPvsvlcrfpfsSALQRMDVVvtwpgATQPEAYVKGspELVaSLCSPETVPSDFSQVLQsy 673
Cdd:PRK11033  486 AIVRE-------AQVRGLAIP----------EAESQRALA-----GSGIEGQVNG--ERV-LICAPGKLPPLADAFAG-- 538
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  674 taagyRVVAL--AGKPLPIapslaaaqqltrdtVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAV 751
Cdd:PRK11033  539 -----QINELesAGKTVVL--------------VLRNDDVLGLIALQDTLRADARQAISELKALGIKGVMLTGDNPRAAA 599

                  ....*...
gi 256985106  752 TVARACGM 759
Cdd:PRK11033  600 AIAGELGI 607
PRK01122 PRK01122
potassium-transporting ATPase subunit B; Provisional
294-349 2.04e-07

potassium-transporting ATPase subunit B; Provisional


Pssm-ID: 234905 [Multi-domain]  Cd Length: 679  Bit Score: 53.66  E-value: 2.04e-07
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 256985106  294 RPGGEEEWVDSSELVPGDcLVLPQEGGVMPCDAALVAGECVVNESSLTGESTPVLK 349
Cdd:PRK01122  110 REPGAAEEVPATELRKGD-IVLVEAGEIIPADGEVIEGVASVDESAITGESAPVIR 164
PRK01122 PRK01122
potassium-transporting ATPase subunit B; Provisional
711-882 7.21e-07

potassium-transporting ATPase subunit B; Provisional


Pssm-ID: 234905 [Multi-domain]  Cd Length: 679  Bit Score: 52.12  E-value: 7.21e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  711 LLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVgaqehlavihathpeqgqpaalEFLptess 790
Cdd:PRK01122  436 VLGVIYLKDIVKPGIKERFAELRKMGIKTVMITGDNPLTAAAIAAEAGVD----------------------DFL----- 488
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  791 avmngAKATgyptvpepqschlalsgstfavlrkhfpkllpkvlvqatvfarmaPEQKTELVCELQRLQYCVGMCGDGAN 870
Cdd:PRK01122  489 -----AEAT---------------------------------------------PEDKLALIRQEQAEGRLVAMTGDGTN 518
                         170
                  ....*....|..
gi 256985106  871 DCGALKAADVGI 882
Cdd:PRK01122  519 DAPALAQADVGV 530
PRK14010 PRK14010
potassium-transporting ATPase subunit B; Provisional
252-759 9.44e-07

potassium-transporting ATPase subunit B; Provisional


Pssm-ID: 184448 [Multi-domain]  Cd Length: 673  Bit Score: 51.62  E-value: 9.44e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  252 YWYALCIFLISAISICLALYKTRKQSLTLRDmVKLSVRVQVCRPGGEEEWVDSSELVPGDcLVLPQEGGVMPCDAALVAG 331
Cdd:PRK14010   69 FIILLLTLVFANFSEALAEGRGKAQANALRQ-TQTEMKARRIKQDGSYEMIDASDLKKGH-IVRVATGEQIPNDGKVIKG 146
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  332 ECVVNESSLTGESTPVLKTALPEGPKPYCPETHRRHTLFCGTLILQARAYVGPRVLAVVTRTGFCTAKGGLVSSILHPRP 411
Cdd:PRK14010  147 LATVDESAITGESAPVIKESGGDFDNVIGGTSVASDWLEVEITSEPGHSFLDKMIGLVEGATRKKTPNEIALFTLLMTLT 226
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  412 ISFkfykhsmkfvaalsvLALLGTVYSIIILYRNRVPVREIVIraldLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCI 491
Cdd:PRK14010  227 IIF---------------LVVILTMYPLAKFLNFNLSIAMLIA----LAVCLIPTTIGGLLSAIGIAGMDRVTQFNILAK 287
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  492 HPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLKGQVLLPLVpepchlplgpllRALATChalSQLHDTPvgdpmdlk 571
Cdd:PRK14010  288 SGRSVETCGDVNVLILDKTGTITYGNRMADAFIPVKSSSFERLV------------KAAYES---SIADDTP-------- 344
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  572 mvestgwvleegpaagsaPGSQVLVVMRpppggprqQEEPPVPVSVLCRFPFsSALQRMDVVvtwpGATQPEAYvKGSPE 651
Cdd:PRK14010  345 ------------------EGRSIVKLAY--------KQHIDLPQEVGEYIPF-TAETRMSGV----KFTTREVY-KGAPN 392
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106  652 LVASLCSPET--VPSDFSQVLQSYTAAGyrvvalaGKPLPIapslaaaqqltrdtVERELsLLGLLVMRNLLKPQTAPVI 729
Cdd:PRK14010  393 SMVKRVKEAGghIPVDLDALVKGVSKKG-------GTPLVV--------------LEDNE-ILGVIYLKDVIKDGLVERF 450
                         490       500       510
                  ....*....|....*....|....*....|
gi 256985106  730 QTLRKTGIRTVMVTGDNLQTAVTVARACGM 759
Cdd:PRK14010  451 RELREMGIETVMCTGDNELTAATIAKEAGV 480
kdpB TIGR01497
K+-transporting ATPase, B subunit; This model describes the P-type ATPase subunit of the ...
268-349 1.82e-06

K+-transporting ATPase, B subunit; This model describes the P-type ATPase subunit of the complex responsible for translocating potassium ions across biological membranes in microbes. In E. coli and other species, this complex consists of the proteins KdpA, KdpB, KdpC and KdpF. KdpB is the ATPase subunit, while KdpA is the potassium-ion translocating subunit. The function of KdpC is unclear, although cit has been suggested to couple the ATPase subunit to the ion-translocating subunit, while KdpF serves to stabilize the complex. The potassium P-type ATPases have been characterized as Type IA based on a phylogenetic analysis which places this clade closest to the heavy-metal translocating ATPases (Type IB). Others place this clade closer to the Na+/K+ antiporter type (Type IIC) based on physical characteristics. This model is very clear-cut, with a strong break between trusted hits and noise. All members of the seed alignment, from Clostridium, Anabaena and E. coli are in the characterized table. One sequence above trusted, OMNI|NTL01TA01282, is apparently mis-annotated in the primary literature, but properly annotated by TIGR. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 130561 [Multi-domain]  Cd Length: 675  Bit Score: 50.65  E-value: 1.82e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   268 LALYKTRKQSLTLRDmVKLSVRVQVCRPGGEEEWVDSSELVPGDcLVLPQEGGVMPCDAALVAGECVVNESSLTGESTPV 347
Cdd:TIGR01497   86 VAEGRGKAQADSLKG-TKKTTFAKLLRDDGAIDKVPADQLKKGD-IVLVEAGDVIPCDGEVIEGVASVDESAITGESAPV 163

                   ..
gi 256985106   348 LK 349
Cdd:TIGR01497  164 IK 165
Hydrolase pfam00702
haloacid dehalogenase-like hydrolase; This family is structurally different from the alpha ...
675-767 8.30e-06

haloacid dehalogenase-like hydrolase; This family is structurally different from the alpha/beta hydrolase family (pfam00561). This family includes L-2-haloacid dehalogenase, epoxide hydrolases and phosphatases. The structure of the family consists of two domains. One is an inserted four helix bundle, which is the least well conserved region of the alignment. The rest of the fold is composed of the core alpha/beta domain. Those members with the characteristic DxD triad at the N-terminus are probably phosphatidylglycerolphosphate (PGP) phosphatases involved in cardiolipin biosynthesis in the mitochondria.


Pssm-ID: 279092 [Multi-domain]  Cd Length: 190  Bit Score: 46.42  E-value: 8.30e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985106   675 AAGYRVVALAGKP-----LPIAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQT 749
Cdd:pfam00702   47 VEDFTARLLLGKRdwleeLGLRGLVETLEAEGLTVVLVELLGVIALADELKLYPGAAEALKALKEKGIKVAILTGDNPEA 126
                           90
                   ....*....|....*...
gi 256985106   750 AVTVARACGMVGAQEHLA 767
Cdd:pfam00702  127 AEALLRLLGLDDYFDVVI 144
copA PRK10671
copper exporting ATPase; Provisional
839-884 6.56e-04

copper exporting ATPase; Provisional


Pssm-ID: 182635 [Multi-domain]  Cd Length: 834  Bit Score: 42.42  E-value: 6.56e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 256985106  839 VFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISL 884
Cdd:PRK10671  692 VIAGVLPDGKAEAIKRLQSQGRQVAMVGDGINDAPALAQADVGIAM 737
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH