NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|24647658|ref|NP_650616|]
View 

Protein Classification

CYCLIN and BRF1 domain-containing protein (domain architecture ID 11444069)

CYCLIN and BRF1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SUA7 COG1405
Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB ...
6-270 5.88e-56

Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription];


:

Pssm-ID: 224323 [Multi-domain]  Cd Length: 285  Bit Score: 191.76  E-value: 5.88e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   6 KCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQ---FEEVGHGAAA-------IGQFVSAE--SSGGATNYGYGK 73
Cdd:COG1405   3 SCPECGSTNIITDYERGEIVCADCGLVLEDSLIDPGPEwraFDERHERRVGapltpsiHDKGLSTIigWGDKDKMYRLRK 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658  74 FQVG-SGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLID 152
Cdd:COG1405  83 WQIRiRVSSAKERNLITALEELERIASALGLPESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACRINGVPRTLDE 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658 153 ISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRFANRLQLGAkthEVSMTALRIVQRMKKDCMHSGRRPTGLCGA 232
Cdd:COG1405 163 IAKALGVSKKEIGRTYRLLVRELKLKIPPVDPSDYIPRFASKLGLSD---EVRRKAIEIVKKAKRAGLTAGKSPAGLAAA 239
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 24647658 233 ALLIAARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAE 270
Cdd:COG1405 240 AIYLASLLLGERRTQKEVAKVAGVTEVTIRNRYKELAD 277
BRF1 pfam07741
Brf1-like TBP-binding domain; This region covers both the Brf homology II and III regions. ...
437-533 1.86e-27

Brf1-like TBP-binding domain; This region covers both the Brf homology II and III regions. This region is involved in binding TATA binding protein.


:

Pssm-ID: 336794  Cd Length: 99  Bit Score: 106.10  E-value: 1.86e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   437 DDLNDDELDQYVLTEEESVAKLEMWKNLNAEYLQEQKERDERLAKEREEGKPER--KKRKPRKKVIGPSSTAGEAIEKML 514
Cdd:pfam07741   1 SDIDDDEIDNYILSEEEVKIKERIWMELNKDYLEEQEEKRLKAEAEEEEGKPKKkrKRKARRKKNGPPAATAAEAVKKML 80
                          90
                  ....*....|....*....
gi 24647658   515 QEKKISSKINYEILKTLTD 533
Cdd:pfam07741  81 QKKKFSKKINYDALKSLFD 99
 
Name Accession Description Interval E-value
SUA7 COG1405
Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB ...
6-270 5.88e-56

Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription];


Pssm-ID: 224323 [Multi-domain]  Cd Length: 285  Bit Score: 191.76  E-value: 5.88e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   6 KCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQ---FEEVGHGAAA-------IGQFVSAE--SSGGATNYGYGK 73
Cdd:COG1405   3 SCPECGSTNIITDYERGEIVCADCGLVLEDSLIDPGPEwraFDERHERRVGapltpsiHDKGLSTIigWGDKDKMYRLRK 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658  74 FQVG-SGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLID 152
Cdd:COG1405  83 WQIRiRVSSAKERNLITALEELERIASALGLPESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACRINGVPRTLDE 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658 153 ISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRFANRLQLGAkthEVSMTALRIVQRMKKDCMHSGRRPTGLCGA 232
Cdd:COG1405 163 IAKALGVSKKEIGRTYRLLVRELKLKIPPVDPSDYIPRFASKLGLSD---EVRRKAIEIVKKAKRAGLTAGKSPAGLAAA 239
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 24647658 233 ALLIAARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAE 270
Cdd:COG1405 240 AIYLASLLLGERRTQKEVAKVAGVTEVTIRNRYKELAD 277
BRF1 pfam07741
Brf1-like TBP-binding domain; This region covers both the Brf homology II and III regions. ...
437-533 1.86e-27

Brf1-like TBP-binding domain; This region covers both the Brf homology II and III regions. This region is involved in binding TATA binding protein.


Pssm-ID: 336794  Cd Length: 99  Bit Score: 106.10  E-value: 1.86e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   437 DDLNDDELDQYVLTEEESVAKLEMWKNLNAEYLQEQKERDERLAKEREEGKPER--KKRKPRKKVIGPSSTAGEAIEKML 514
Cdd:pfam07741   1 SDIDDDEIDNYILSEEEVKIKERIWMELNKDYLEEQEEKRLKAEAEEEEGKPKKkrKRKARRKKNGPPAATAAEAVKKML 80
                          90
                  ....*....|....*....
gi 24647658   515 QEKKISSKINYEILKTLTD 533
Cdd:pfam07741  81 QKKKFSKKINYDALKSLFD 99
tfb PRK00423
transcription initiation factor IIB; Reviewed
1-270 1.30e-26

transcription initiation factor IIB; Reviewed


Pssm-ID: 234758 [Multi-domain]  Cd Length: 310  Bit Score: 110.48  E-value: 1.30e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658    1 MSTGLKCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLI---------VSEvQFEE---VG-------H--GAAAIGQFVS 59
Cdd:PRK00423   8 EEEKLVCPECGSDKLIYDYERGEIVCADCGLVIEENIIdqgpewrafDPE-QREKrsrVGapmtytiHdkGLSTDIDWRN 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   60 AESSGG-------ATNYGYGKFQ----VGSGTESrevTIKKAKKDITLLCQQLQLSQHYADTALNFFKMALGRHLTRGRK 128
Cdd:PRK00423  87 KDSYGKsisgknrAQLYRLRKWQrrirVSNAAER---NLAFALSELDRIASQLGLPRSVREEAAVIYRKAVEKGLIRGRS 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658  129 STHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRFANRLQLGAkthEVSMTA 208
Cdd:PRK00423 164 IEGVVAAALYAACRRCKVPRTLDEIAEVSRVSRKEIGRCYRFLLRELNLKLPPTDPIDYVPRFASELGLSG---EVQKKA 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 24647658  209 LRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAE 270
Cdd:PRK00423 241 IEILQKAKEKGLTSGKGPTGLAAAAIYIASLLLGERRTQREVAEVAGVTEVTVRNRYKELAE 302
TF_Zn_Ribbon pfam08271
TFIIB zinc-binding; The transcription factor TFIIB contains a zinc-binding motif near the ...
6-46 6.04e-13

TFIIB zinc-binding; The transcription factor TFIIB contains a zinc-binding motif near the N-terminus. This domain is involved in the interaction with RNA pol II and TFIIF and plays a crucial role in selecting the transcription initiation site. The domain adopts a zinc ribbon like structure.


Pssm-ID: 336978 [Multi-domain]  Cd Length: 42  Bit Score: 63.09  E-value: 6.04e-13
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 24647658     6 KCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQFEE 46
Cdd:pfam08271   1 KCPNCGSTNLVEDYERGELVCTDCGLVLEDNSIDEGPEWRE 41
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
183-268 3.84e-09

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 53.78  E-value: 3.84e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658 183 DPCLYIMRFANRLQLgakTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIH-ESTL 261
Cdd:cd00043   4 TPLDFLRRVAKALGL---SPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTGYAtEEEI 80

                ....*..
gi 24647658 262 RKRLSEF 268
Cdd:cd00043  81 LRMEKLL 87
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
187-270 9.02e-06

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641 [Multi-domain]  Cd Length: 83  Bit Score: 44.12  E-value: 9.02e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658    187 YIMRFANRLQLgakTHEVSMTALRIVQR--MKKDCMHsgRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIH-ESTLRK 263
Cdd:smart00385   2 FLRRVCKALNL---DPETLNLAVNLLDRflSDYKFLK--YSPSLIAAAALYLASKTEETPPWTKELVHYTGYFtEEEILR 76

                   ....*..
gi 24647658    264 RLSEFAE 270
Cdd:smart00385  77 MERLLLE 83
 
Name Accession Description Interval E-value
SUA7 COG1405
Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB ...
6-270 5.88e-56

Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription];


Pssm-ID: 224323 [Multi-domain]  Cd Length: 285  Bit Score: 191.76  E-value: 5.88e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   6 KCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQ---FEEVGHGAAA-------IGQFVSAE--SSGGATNYGYGK 73
Cdd:COG1405   3 SCPECGSTNIITDYERGEIVCADCGLVLEDSLIDPGPEwraFDERHERRVGapltpsiHDKGLSTIigWGDKDKMYRLRK 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658  74 FQVG-SGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLID 152
Cdd:COG1405  83 WQIRiRVSSAKERNLITALEELERIASALGLPESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACRINGVPRTLDE 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658 153 ISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRFANRLQLGAkthEVSMTALRIVQRMKKDCMHSGRRPTGLCGA 232
Cdd:COG1405 163 IAKALGVSKKEIGRTYRLLVRELKLKIPPVDPSDYIPRFASKLGLSD---EVRRKAIEIVKKAKRAGLTAGKSPAGLAAA 239
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 24647658 233 ALLIAARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAE 270
Cdd:COG1405 240 AIYLASLLLGERRTQKEVAKVAGVTEVTIRNRYKELAD 277
BRF1 pfam07741
Brf1-like TBP-binding domain; This region covers both the Brf homology II and III regions. ...
437-533 1.86e-27

Brf1-like TBP-binding domain; This region covers both the Brf homology II and III regions. This region is involved in binding TATA binding protein.


Pssm-ID: 336794  Cd Length: 99  Bit Score: 106.10  E-value: 1.86e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   437 DDLNDDELDQYVLTEEESVAKLEMWKNLNAEYLQEQKERDERLAKEREEGKPER--KKRKPRKKVIGPSSTAGEAIEKML 514
Cdd:pfam07741   1 SDIDDDEIDNYILSEEEVKIKERIWMELNKDYLEEQEEKRLKAEAEEEEGKPKKkrKRKARRKKNGPPAATAAEAVKKML 80
                          90
                  ....*....|....*....
gi 24647658   515 QEKKISSKINYEILKTLTD 533
Cdd:pfam07741  81 QKKKFSKKINYDALKSLFD 99
tfb PRK00423
transcription initiation factor IIB; Reviewed
1-270 1.30e-26

transcription initiation factor IIB; Reviewed


Pssm-ID: 234758 [Multi-domain]  Cd Length: 310  Bit Score: 110.48  E-value: 1.30e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658    1 MSTGLKCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLI---------VSEvQFEE---VG-------H--GAAAIGQFVS 59
Cdd:PRK00423   8 EEEKLVCPECGSDKLIYDYERGEIVCADCGLVIEENIIdqgpewrafDPE-QREKrsrVGapmtytiHdkGLSTDIDWRN 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658   60 AESSGG-------ATNYGYGKFQ----VGSGTESrevTIKKAKKDITLLCQQLQLSQHYADTALNFFKMALGRHLTRGRK 128
Cdd:PRK00423  87 KDSYGKsisgknrAQLYRLRKWQrrirVSNAAER---NLAFALSELDRIASQLGLPRSVREEAAVIYRKAVEKGLIRGRS 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658  129 STHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRFANRLQLGAkthEVSMTA 208
Cdd:PRK00423 164 IEGVVAAALYAACRRCKVPRTLDEIAEVSRVSRKEIGRCYRFLLRELNLKLPPTDPIDYVPRFASELGLSG---EVQKKA 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 24647658  209 LRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAE 270
Cdd:PRK00423 241 IEILQKAKEKGLTSGKGPTGLAAAAIYIASLLLGERRTQREVAEVAGVTEVTVRNRYKELAE 302
TF_Zn_Ribbon pfam08271
TFIIB zinc-binding; The transcription factor TFIIB contains a zinc-binding motif near the ...
6-46 6.04e-13

TFIIB zinc-binding; The transcription factor TFIIB contains a zinc-binding motif near the N-terminus. This domain is involved in the interaction with RNA pol II and TFIIF and plays a crucial role in selecting the transcription initiation site. The domain adopts a zinc ribbon like structure.


Pssm-ID: 336978 [Multi-domain]  Cd Length: 42  Bit Score: 63.09  E-value: 6.04e-13
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 24647658     6 KCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQFEE 46
Cdd:pfam08271   1 KCPNCGSTNLVEDYERGELVCTDCGLVLEDNSIDEGPEWRE 41
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
183-268 3.84e-09

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 53.78  E-value: 3.84e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658 183 DPCLYIMRFANRLQLgakTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIH-ESTL 261
Cdd:cd00043   4 TPLDFLRRVAKALGL---SPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTGYAtEEEI 80

                ....*..
gi 24647658 262 RKRLSEF 268
Cdd:cd00043  81 LRMEKLL 87
TFIIB pfam00382
Transcription factor TFIIB repeat;
108-164 7.65e-09

Transcription factor TFIIB repeat;


Pssm-ID: 278794 [Multi-domain]  Cd Length: 71  Bit Score: 52.31  E-value: 7.65e-09
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 24647658   108 ADTALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYEL 164
Cdd:pfam00382  15 ADAANEIAKLALDDNFLKGRSPAGIAAACLYIACRLEEVKRTFKEISSVLQVSEKTI 71
TFIIB pfam00382
Transcription factor TFIIB repeat;
188-261 2.01e-08

Transcription factor TFIIB repeat;


Pssm-ID: 278794 [Multi-domain]  Cd Length: 71  Bit Score: 51.16  E-value: 2.01e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 24647658   188 IMRFANRLQLGAKtheVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIHESTL 261
Cdd:pfam00382   1 IKRFADALELPKK---VADAANEIAKLALDDNFLKGRSPAGIAAACLYIACRLEEVKRTFKEISSVLQVSEKTI 71
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
110-171 2.88e-07

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 48.39  E-value: 2.88e-07
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 24647658 110 TALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICS-YELGRTYLKL 171
Cdd:cd00043  25 LAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTGYATeEEILRMEKLL 87
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
187-270 9.02e-06

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641 [Multi-domain]  Cd Length: 83  Bit Score: 44.12  E-value: 9.02e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24647658    187 YIMRFANRLQLgakTHEVSMTALRIVQR--MKKDCMHsgRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIH-ESTLRK 263
Cdd:smart00385   2 FLRRVCKALNL---DPETLNLAVNLLDRflSDYKFLK--YSPSLIAAAALYLASKTEETPPWTKELVHYTGYFtEEEILR 76

                   ....*..
gi 24647658    264 RLSEFAE 270
Cdd:smart00385  77 MERLLLE 83
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
110-171 1.59e-03

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641 [Multi-domain]  Cd Length: 83  Bit Score: 37.57  E-value: 1.59e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 24647658    110 TALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSY-ELGRTYLKL 171
Cdd:smart00385  19 LAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGYFTEeEILRMERLL 81
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH