NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|23308635|ref|NP_694497|]
View 

glycine receptor subunit alpha-3 precursor [Danio rerio]

Protein Classification

LIC family protein (domain architecture ID 11489802)

LIC family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
LIC TIGR00860
Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of ...
12-439 0e+00

Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective). [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 273305  Cd Length: 459  Bit Score: 540.07  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    12 RGFIAWEIGILLSLVASKEPESPRRRAAPMsPPDFLDKLMGrtsGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDY 91
Cdd:TIGR00860   1 LSQILLALLLFASLAAVSLAGNAKSNLKEV-ERKLLDELLK---NYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    92 RVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSC 171
Cdd:TIGR00860  77 TTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFYNEKDARFHGITMTNVLVRIHPNGSVLYSPRITLTLAC 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   172 PMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEKGPVQVADGL--TLPQFILKDESDLRYCTKHYNTGKFTCIEVRFHL 249
Cdd:TIGR00860 157 PMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQVDDSLfiSLPEFELLGVYGTRYCTSETNTGEYPCLTFSFVL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   250 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFS 329
Cdd:TIGR00860 237 RRRPLYYLLQLYIPSILIVILSWVSFWLPADASGARVSLGITTLLTMTTFSSGVRESLPAVSYVKAIDVYFAVCMAFVFL 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   330 ALLEYAAVNFVSRQ-------HKELLRFRRRRKKSGKEEEVRE------SRLSFTPNAGKDGAVP--KTANNAATTPSEP 394
Cdd:TIGR00860 317 ALLETAFVNYVHHKdpaqgkrHLLLERCAWRLCKQEPGEDYRRpaldhaSLSSVEMRAKDGGRGLesPTERQRLLHSPPP 396
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 23308635   395 AVA------------------PGKSHEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLY 439
Cdd:TIGR00860 397 AEGdldlagileevriahrfrKRDESEEVVRDWKFRAKVIDKLSRMAFPLAFLLFNIGYWMSY 459
 
Name Accession Description Interval E-value
LIC TIGR00860
Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of ...
12-439 0e+00

Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective). [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273305  Cd Length: 459  Bit Score: 540.07  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    12 RGFIAWEIGILLSLVASKEPESPRRRAAPMsPPDFLDKLMGrtsGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDY 91
Cdd:TIGR00860   1 LSQILLALLLFASLAAVSLAGNAKSNLKEV-ERKLLDELLK---NYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    92 RVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSC 171
Cdd:TIGR00860  77 TTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFYNEKDARFHGITMTNVLVRIHPNGSVLYSPRITLTLAC 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   172 PMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEKGPVQVADGL--TLPQFILKDESDLRYCTKHYNTGKFTCIEVRFHL 249
Cdd:TIGR00860 157 PMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQVDDSLfiSLPEFELLGVYGTRYCTSETNTGEYPCLTFSFVL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   250 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFS 329
Cdd:TIGR00860 237 RRRPLYYLLQLYIPSILIVILSWVSFWLPADASGARVSLGITTLLTMTTFSSGVRESLPAVSYVKAIDVYFAVCMAFVFL 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   330 ALLEYAAVNFVSRQ-------HKELLRFRRRRKKSGKEEEVRE------SRLSFTPNAGKDGAVP--KTANNAATTPSEP 394
Cdd:TIGR00860 317 ALLETAFVNYVHHKdpaqgkrHLLLERCAWRLCKQEPGEDYRRpaldhaSLSSVEMRAKDGGRGLesPTERQRLLHSPPP 396
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 23308635   395 AVA------------------PGKSHEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLY 439
Cdd:TIGR00860 397 AEGdldlagileevriahrfrKRDESEEVVRDWKFRAKVIDKLSRMAFPLAFLLFNIGYWMSY 459
Neur_chan_LBD pfam02931
Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ...
47-253 2.31e-65

Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure.


Pssm-ID: 308532  Cd Length: 215  Bit Score: 212.11  E-value: 2.31e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    47 LDKLMgrtSGYDARIRPN-FKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAY--SEYPD-DSLDLDPsm 122
Cdd:pfam02931   5 LDDLL---SGYDKLVRPVeNGSDPVTVSIGLYLQQIIDVDEKNQDLTTNVWLRQQWTDERLKWnpEDYGGiTSLRLPS-- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   123 lDSIWKPDLFFANeKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFE 202
Cdd:pfam02931  80 -DKIWKPDIFLYN-KADGIHEVTTPNTNVRIYYDGTVLWSPPAIYKSSCSIDVTYFPFDEQNCSLKFGSWTYNGEEVDLR 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 23308635   203 WQEKGPVQVADGLTLPQFILKDESDLRY--CTKHYNTGKFTC-----IEVRFHLERQM 253
Cdd:pfam02931 158 WKDDPPVVELEEIDLSDFTLNGEWDIVDvpAKRRETPYGCYSelygdVTFYFTLRRKP 215
 
Name Accession Description Interval E-value
LIC TIGR00860
Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of ...
12-439 0e+00

Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective). [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273305  Cd Length: 459  Bit Score: 540.07  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    12 RGFIAWEIGILLSLVASKEPESPRRRAAPMsPPDFLDKLMGrtsGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDY 91
Cdd:TIGR00860   1 LSQILLALLLFASLAAVSLAGNAKSNLKEV-ERKLLDELLK---NYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    92 RVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSC 171
Cdd:TIGR00860  77 TTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFYNEKDARFHGITMTNVLVRIHPNGSVLYSPRITLTLAC 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   172 PMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEKGPVQVADGL--TLPQFILKDESDLRYCTKHYNTGKFTCIEVRFHL 249
Cdd:TIGR00860 157 PMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQVDDSLfiSLPEFELLGVYGTRYCTSETNTGEYPCLTFSFVL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   250 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFS 329
Cdd:TIGR00860 237 RRRPLYYLLQLYIPSILIVILSWVSFWLPADASGARVSLGITTLLTMTTFSSGVRESLPAVSYVKAIDVYFAVCMAFVFL 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   330 ALLEYAAVNFVSRQ-------HKELLRFRRRRKKSGKEEEVRE------SRLSFTPNAGKDGAVP--KTANNAATTPSEP 394
Cdd:TIGR00860 317 ALLETAFVNYVHHKdpaqgkrHLLLERCAWRLCKQEPGEDYRRpaldhaSLSSVEMRAKDGGRGLesPTERQRLLHSPPP 396
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 23308635   395 AVA------------------PGKSHEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLY 439
Cdd:TIGR00860 397 AEGdldlagileevriahrfrKRDESEEVVRDWKFRAKVIDKLSRMAFPLAFLLFNIGYWMSY 459
Neur_chan_LBD pfam02931
Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ...
47-253 2.31e-65

Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure.


Pssm-ID: 308532  Cd Length: 215  Bit Score: 212.11  E-value: 2.31e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635    47 LDKLMgrtSGYDARIRPN-FKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAY--SEYPD-DSLDLDPsm 122
Cdd:pfam02931   5 LDDLL---SGYDKLVRPVeNGSDPVTVSIGLYLQQIIDVDEKNQDLTTNVWLRQQWTDERLKWnpEDYGGiTSLRLPS-- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   123 lDSIWKPDLFFANeKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFE 202
Cdd:pfam02931  80 -DKIWKPDIFLYN-KADGIHEVTTPNTNVRIYYDGTVLWSPPAIYKSSCSIDVTYFPFDEQNCSLKFGSWTYNGEEVDLR 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 23308635   203 WQEKGPVQVADGLTLPQFILKDESDLRY--CTKHYNTGKFTC-----IEVRFHLERQM 253
Cdd:pfam02931 158 WKDDPPVVELEEIDLSDFTLNGEWDIVDvpAKRRETPYGCYSelygdVTFYFTLRRKP 215
Neur_chan_memb pfam02932
Neurotransmitter-gated ion-channel transmembrane region; This family includes the four ...
260-436 3.29e-47

Neurotransmitter-gated ion-channel transmembrane region; This family includes the four transmembrane helices that form the ion channel.


Pssm-ID: 308533  Cd Length: 232  Bit Score: 164.76  E-value: 3.29e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   260 MYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDI-WMAVCLLFVFSALLEYAAVN 338
Cdd:pfam02932   1 LIIPCVLISFLSWLVFWLPADAVGEKVTLGITVLLTMTVFLLLIRESLPKTSYVVPLIGkYLLFCMVFVFLSLVEYVIVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23308635   339 FVS----RQHK-----------------------ELLRFRRRRKKSGKEEEV---------------------RESRLSF 370
Cdd:pfam02932  81 NVHhrspSTHKmppwvrkifleklprllgmkrppEAPPPPASPGYGSKAEEYilrkprselmfekqserhglgRETTCSY 160
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 23308635   371 TPNAGKDGAVPKTANNAATTPSE------PAVAPGKSHEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYW 436
Cdd:pfam02932 161 GCSLGNGSSQPRSLSPELKKAVEgvnfiaKHLRSQDEYISVKEDWKYVAMVIDRLSRWIFPIAFVLGTLGYF 232
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH