NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|22299155|ref|NP_682402|]
View 

hypothetical protein tlr1612 [Thermosynechococcus elongatus BP-1]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
COG5001 super family cl25447
Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain ...
848-1284 1.40e-102

Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms];


The actual alignment was detected with superfamily member PRK10060:

Pssm-ID: 330268  Cd Length: 663  Bit Score: 343.20  E-value: 1.40e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   848 DVTSRVQVQMQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNpqfHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFAT 927
Cdd:PRK10060  222 DITEERRAQERLRILANTDSITGLPNRNAIQELIDHAINAADNN---QVGIVYLDLDNFKKVNDAYGHMFGDQLLQDVSL 298
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   928 WLRRLVGNQYTVARFGGDEFVILLTHVPHPQRAiALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRDA 1007
Cdd:PRK10060  299 AILSCLEEDQTLARLGGDEFLVLASHTSQAALE-AMASRILTRLRLPFRIGLIEVYTGCSIGIALAPEHGDDSESLIRSA 377
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1008 DTAMYAAKRQSGRRYAVFDTQMYEQVLERLHLEHDLRQALNQGGLQLLYQPVVHLqSQRLVGMEALVRWQHPERGLVSPA 1087
Cdd:PRK10060  378 DTAMYTAKEGGRGQFCVFSPEMNQRVFEYLWLDTNLRKALENDQLVIHYQPKITW-RGEVRSLEALVRWQSPERGLIPPL 456
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1088 HFIPIAEDTGLIVALDQWALAQACWQLWTWRQQystAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTE 1167
Cdd:PRK10060  457 EFISYAEESGLIVPLGRWVMLDVVRQVAKWRDK---GINLRVAVNVSARQLADQTIFTALKQALQELNFEYCPIDVELTE 533
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1168 RIGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYR 1247
Cdd:PRK10060  534 SCLIENEELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQSFVRDIHKQPVSQSLVRAIVAVAQALNLQ 613
                         410       420       430
                  ....*....|....*....|....*....|....*..
gi 22299155  1248 VIAEGIETPKQLQILQELGCDEGQGYLFARPLPPETF 1284
Cdd:PRK10060  614 VIAEGVETAKEDAFLTKNGVNERQGFLFAKPMPAVAF 650
PAS super family cl25988
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
466-859 2.76e-25

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


The actual alignment was detected with superfamily member PRK13560:

Pssm-ID: 330809  Cd Length: 807  Bit Score: 113.23  E-value: 2.76e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   466 RRRIEATLRQS-EECFRLTATNVPGAIFRYIQYPDGRNRVFYLNPMCERLWGVPAEAAAEDGEHLWQLVHPEDREATWQS 544
Cdd:PRK13560   55 RAIAEAEAQDCrEQCERNLKANIPGGMFLFALDGDGTFSFPSLLDANGELAAIAKHDLMADKGLLAMLIGGDDGDFFFAN 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   545 VLRSAETLTPWFAQ--WR--IIHPTTGEIRWLEGAGQPTRDADGAVVWHTVILDVTDRHLAEARLKEQQAQLELAARVSN 620
Cdd:PRK13560  135 PFRSAETIAMALQSddWQeeEGHFRCGDGRFIDCCLRFERHAHADDQVDGFAEDITERKRAEERIDEALHFLQQLLDNIA 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   621 IGFYFCDLHTGTFYVSPSYKAQLGY--------------PATTQEVNLE-DWeERLHPeDRDRALAAYRQfLRGEAHYSI 685
Cdd:PRK13560  215 DPAFWKDEDAKVFGCNDAACLACGFrreeiigmsihdfaPAQPADDYQEaDA-AKFDA-DGSQIIEAEFQ-NKDGRTRPV 291
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   686 DLRLRHcngtyrwfhseaVLIHDEQGQPSKVVGTNVDITERKATELALRESEERYRLLAENTSDIICLLDCQGS-CLYVS 764
Cdd:PRK13560  292 DVIFNH------------AEFDDKENHCAGLVGAITDISGRRAAERELLEKEDMLRAIIEAAPIAAIGLDADGNiCFVNN 359
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   765 PSYETLLGWPTETLIGEHFTQLcHPEERSRVK----QELQQMIEQRQFWPITYQVCTARGDVL-WLETLV---------- 829
Cdd:PRK13560  360 NAAERMLGWSAAEVMGKPLPGM-DPELNEEFWcgdfQEWYPDGRPMAFDACPMAKTIKGGKIFdGQEVLIereddgpadc 438
                         410       420       430
                  ....*....|....*....|....*....|....
gi 22299155   830 ----KPRYDSQGHVQQLQTTSRDVTSRVQVQMQL 859
Cdd:PRK13560  439 sayaEPLHDADGNIIGAIALLVDITERKQVEEQL 472
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
311-460 6.36e-15

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


:

Pssm-ID: 214500  Cd Length: 149  Bit Score: 75.11  E-value: 6.36e-15
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155     311 DLATIFETAVREIAQVgLGVDAAVVQYLPEQGVWRHIAEYHHDPHFPCgEGLEIPDRDNPFAADLKAGNIVIIADSREIT 390
Cdd:smart00065    1 DLEELLQTILEELRQL-LGADRVLIYLVDENDRGELVLVAADGLTLPT-LGIRFPLDEGLAGRVAETGRPLNIPDVEADP 78
                            90       100       110       120       130       140       150
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22299155     391 DPVNQAIAPA-FPGAWLLIPLIVADRVWGSLTLFNYPEPHEWSRTEIDLARAVATQLEVAIYQATLYQQAQ 460
Cdd:smart00065   79 LFAEDLLGRYqGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLAIALANAQLYEELR 149
PAS COG2202
PAS domain [Signal transduction mechanisms];
49-292 9.25e-11

PAS domain [Signal transduction mechanisms];


:

Pssm-ID: 225112  Cd Length: 232  Bit Score: 63.33  E-value: 9.25e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   49 GVALYDVTGEIVYMNPAGRALLGVEDpattasqicADLRIFYCgSDRPYPKDELPGIQALQGLTVPPMELEVQ---YGDR 125
Cdd:COG2202    1 LILVLDRDGRIIYANEAAEELLGYSA---------EELLGLLL-ALHPEDRDRLRELLRRLLAGEELLSEELRlvrKDGE 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  126 QLTVEVQASPILNPAGQVEFSISTfWEITARKRSELEqqilknyWQAQANRYYEILQSQSDLVLCSRADTTITFANDAFC 205
Cdd:COG2202   71 ERWVELSAAPLRDGEGRVLGLLGL-RDITERKRAEEA-------LRESEERLRALLEASPDGIWVLDEDGRILYANPAAE 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  206 QFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQ--LRPDAPTFVNENRVYHPQYGLRWTQWMNTAIFDAEGNLREIQSVG 283
Cdd:COG2202  143 ELLGYSPEEELGRGLSDLIHPEDEERRELELARalAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIA 222

                 ....*....
gi 22299155  284 RDITALKEQ 292
Cdd:COG2202  223 RDITERKQA 231
 
Name Accession Description Interval E-value
PRK10060 PRK10060
RNase II stability modulator; Provisional
848-1284 1.40e-102

RNase II stability modulator; Provisional


Pssm-ID: 236645  Cd Length: 663  Bit Score: 343.20  E-value: 1.40e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   848 DVTSRVQVQMQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNpqfHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFAT 927
Cdd:PRK10060  222 DITEERRAQERLRILANTDSITGLPNRNAIQELIDHAINAADNN---QVGIVYLDLDNFKKVNDAYGHMFGDQLLQDVSL 298
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   928 WLRRLVGNQYTVARFGGDEFVILLTHVPHPQRAiALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRDA 1007
Cdd:PRK10060  299 AILSCLEEDQTLARLGGDEFLVLASHTSQAALE-AMASRILTRLRLPFRIGLIEVYTGCSIGIALAPEHGDDSESLIRSA 377
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1008 DTAMYAAKRQSGRRYAVFDTQMYEQVLERLHLEHDLRQALNQGGLQLLYQPVVHLqSQRLVGMEALVRWQHPERGLVSPA 1087
Cdd:PRK10060  378 DTAMYTAKEGGRGQFCVFSPEMNQRVFEYLWLDTNLRKALENDQLVIHYQPKITW-RGEVRSLEALVRWQSPERGLIPPL 456
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1088 HFIPIAEDTGLIVALDQWALAQACWQLWTWRQQystAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTE 1167
Cdd:PRK10060  457 EFISYAEESGLIVPLGRWVMLDVVRQVAKWRDK---GINLRVAVNVSARQLADQTIFTALKQALQELNFEYCPIDVELTE 533
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1168 RIGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYR 1247
Cdd:PRK10060  534 SCLIENEELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQSFVRDIHKQPVSQSLVRAIVAVAQALNLQ 613
                         410       420       430
                  ....*....|....*....|....*....|....*..
gi 22299155  1248 VIAEGIETPKQLQILQELGCDEGQGYLFARPLPPETF 1284
Cdd:PRK10060  614 VIAEGVETAKEDAFLTKNGVNERQGFLFAKPMPAVAF 650
EAL cd01948
EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1041-1282 5.41e-101

EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.


Pssm-ID: 238923  Cd Length: 240  Bit Score: 323.34  E-value: 5.41e-101
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1041 HDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLWTWRQQ 1120
Cdd:cd01948    1 ADLRRALERGEFELYYQPIVDLRTGRIVGYEALLRWRHPEGGLISPAEFIPLAEETGLIVELGRWVLEEACRQLARWQAG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1121 YstaANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTGY 1200
Cdd:cd01948   81 G---PDLRLSVNLSARQLRDPDFLDRLLELLAETGLPPRRLVLEITESALIDDLEEALATLRRLRALGVRIALDDFGTGY 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1201 SCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPLP 1280
Cdd:cd01948  158 SSLSYLKRLPVDYLKIDRSFVRDIETDPEDRAIVRAIIALAHSLGLKVVAEGVETEEQLELLRELGCDYVQGYLFSRPLP 237

                 ..
gi 22299155 1281 PE 1282
Cdd:cd01948  238 AE 239
EAL COG2200
EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) ...
1036-1291 8.52e-96

EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) [Signal transduction mechanisms];


Pssm-ID: 225110  Cd Length: 256  Bit Score: 309.61  E-value: 8.52e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1036 RLHLEHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLW 1115
Cdd:COG2200    1 RLQLERDLRQALENGEFSLYYQPIVDLATGRIVGYEALLRWRHPDGGLISPGEFIPLAEETGLIVELGRWVLEEACRQLR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1116 TWRQQystaANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDD 1195
Cdd:COG2200   81 TWPRA----GPLRLAVNLSPVQLRSPGLVDLLLRLLARLGLPPHRLVLEITESALIDDLDTALALLRQLRELGVRIALDD 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1196 FGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLF 1275
Cdd:COG2200  157 FGTGYSSLSYLKRLPPDILKIDRSFVRDLETDARDQAIVRAIVALAHKLGLTVVAEGVETEEQLDLLRELGCDYLQGYLF 236
                        250
                 ....*....|....*.
gi 22299155 1276 ARPLPPETFASLFLKP 1291
Cdd:COG2200  237 SRPLPADALDALLSSS 252
EAL smart00052
Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a ...
1040-1283 5.11e-92

Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a variety of bacteria.


Pssm-ID: 214491  Cd Length: 242  Bit Score: 298.36  E-value: 5.11e-92
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    1040 EHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLWTWRQ 1119
Cdd:smart00052    1 ERELRQALENGQFLLYYQPIVSLRTGRLVGVEALIRWQHPEGGIISPDEFIPLAEETGLIVPLGRWVLEQACQQLAEWQA 80
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    1120 QysTAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTG 1199
Cdd:smart00052   81 Q--GPPPLLISINLSARQLISPDLVPRVLELLEETGLPPQRLELEITESVLLDDDESAVATLQRLRELGVRIALDDFGTG 158
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    1200 YSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPL 1279
Cdd:smart00052  159 YSSLSYLKRLPVDLLKIDKSFVRDLQTDPEDEAIVQSIIELAQKLGLQVVAEGVETPEQLDLLRSLGCDYGQGYLFSRPL 238

                    ....
gi 22299155    1280 PPET 1283
Cdd:smart00052  239 PLDD 242
EAL pfam00563
EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1042-1278 4.15e-76

EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.


Pssm-ID: 306937  Cd Length: 235  Bit Score: 253.78  E-value: 4.15e-76
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   1042 DLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLwtwrQQY 1121
Cdd:pfam00563    3 ALRQALENGEFILYYQPIVDLRTGRVVGYEALLRWQHPDGGLISPDRFLPLAERLGLIAELDRWVLEQVLADL----RRL 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   1122 STAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTGYS 1201
Cdd:pfam00563   79 ALDPDIKLSINLSPASLADPSFLERLRELLKQSGPPPSRLVLEITESDLLARLEALQELLARLRALGIRIALDDFGTGYS 158
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22299155   1202 CLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARP 1278
Cdd:pfam00563  159 SLSYLRRLPPDFIKIDRSLIRDIDKDPEAQAIVRALIALARELGIKVVAEGVETEEQLEALKELGCDLVQGYYFSKP 235
GGDEF TIGR00254
diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by ...
863-1026 1.09e-32

diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by many proteins carrying the domain. There is evidence that the domain has diguanylate cyclase activity. Several proteins carrying this domain also carry domains with functions relating to environmental sensing. These include PleD, a response regulator protein involved in the swarmer-to-stalked cell transition in Caulobacter crescentus, and FixL, a heme-containing oxygen sensor protein. [Regulatory functions, Small molecule interactions, Signal transduction, Other]


Pssm-ID: 272984  Cd Length: 165  Bit Score: 127.45  E-value: 1.09e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    863 AYHDSLTGLPNRLYFMEQLAAAISQAQTNpQFHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARF 942
Cdd:TIGR00254    2 AVRDPLTGLYNRRYLEEMLDSELKRARRF-QRSFSVLMIDIDNFKKINDTLGHDVGDEVLREVARILQSSVRGSDVVGRY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    943 GGDEFVILLTHVPHPQrAIALCEELIHSL-QQPLRVGER-QIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKrQSGR 1020
Cdd:TIGR00254   81 GGEEFVVILPGTPLED-ALSKAERLRDAInSKPIEVAGSeTLTVTVSIGVACYPGHGLTLEELLKRADEALYQAK-KAGR 158

                   ....*..
gi 22299155   1021 -RYAVFD 1026
Cdd:TIGR00254  159 nRVVVAD 165
PRK13560 PRK13560
hypothetical protein; Provisional
466-859 2.76e-25

hypothetical protein; Provisional


Pssm-ID: 106506  Cd Length: 807  Bit Score: 113.23  E-value: 2.76e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   466 RRRIEATLRQS-EECFRLTATNVPGAIFRYIQYPDGRNRVFYLNPMCERLWGVPAEAAAEDGEHLWQLVHPEDREATWQS 544
Cdd:PRK13560   55 RAIAEAEAQDCrEQCERNLKANIPGGMFLFALDGDGTFSFPSLLDANGELAAIAKHDLMADKGLLAMLIGGDDGDFFFAN 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   545 VLRSAETLTPWFAQ--WR--IIHPTTGEIRWLEGAGQPTRDADGAVVWHTVILDVTDRHLAEARLKEQQAQLELAARVSN 620
Cdd:PRK13560  135 PFRSAETIAMALQSddWQeeEGHFRCGDGRFIDCCLRFERHAHADDQVDGFAEDITERKRAEERIDEALHFLQQLLDNIA 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   621 IGFYFCDLHTGTFYVSPSYKAQLGY--------------PATTQEVNLE-DWeERLHPeDRDRALAAYRQfLRGEAHYSI 685
Cdd:PRK13560  215 DPAFWKDEDAKVFGCNDAACLACGFrreeiigmsihdfaPAQPADDYQEaDA-AKFDA-DGSQIIEAEFQ-NKDGRTRPV 291
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   686 DLRLRHcngtyrwfhseaVLIHDEQGQPSKVVGTNVDITERKATELALRESEERYRLLAENTSDIICLLDCQGS-CLYVS 764
Cdd:PRK13560  292 DVIFNH------------AEFDDKENHCAGLVGAITDISGRRAAERELLEKEDMLRAIIEAAPIAAIGLDADGNiCFVNN 359
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   765 PSYETLLGWPTETLIGEHFTQLcHPEERSRVK----QELQQMIEQRQFWPITYQVCTARGDVL-WLETLV---------- 829
Cdd:PRK13560  360 NAAERMLGWSAAEVMGKPLPGM-DPELNEEFWcgdfQEWYPDGRPMAFDACPMAKTIKGGKIFdGQEVLIereddgpadc 438
                         410       420       430
                  ....*....|....*....|....*....|....
gi 22299155   830 ----KPRYDSQGHVQQLQTTSRDVTSRVQVQMQL 859
Cdd:PRK13560  439 sayaEPLHDADGNIIGAIALLVDITERKQVEEQL 472
PAS COG2202
PAS domain [Signal transduction mechanisms];
494-730 2.70e-20

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 92.99  E-value: 2.70e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  494 YIQYPDGRNRVFYLNPMCERLWGVpaeaAAEDGEHLWQLVHPEDREATWQSVLRSAETLTPWFAQWRIIHPTtGEIRWLE 573
Cdd:COG2202    1 LILVLDRDGRIIYANEAAEELLGY----SAEELLGLLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKD-GEERWVE 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  574 GAGQPTRDADGAVVWHTVILDVTDRHLAEARLKEQQAQLELAARVSNIGFYFCDLHTGTFYVSPSYKAQLGYPATTQEVN 653
Cdd:COG2202   76 LSAAPLRDGEGRVLGLLGLRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGR 155
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22299155  654 LEDWEERLHPEDRDRALAAYRQFLRGEAHYSIDLRLRHCNGTYRWFHSEAVLIHDEQGQPSKVVGTNVDITERKATE 730
Cdd:COG2202  156 GLSDLIHPEDEERRELELARALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
634-720 5.28e-18

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312074  Cd Length: 89  Bit Score: 82.39  E-value: 5.28e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    634 YVSPSYKAQLGYpaTTQEV--NLEDWEERLHPEDRDRALAAYRQFLRGEAHYSIDLRLRHCNGTYRWFHSEAVLIHDEQG 711
Cdd:pfam08447    3 YWSPRFEEILGY--TPEELlgKGESWLDLVHPDDRERVREALWEALKGGEPYSGEYRIRRKDGEYRWVEARARPIRDENG 80

                   ....*....
gi 22299155    712 QPSKVVGTN 720
Cdd:pfam08447   81 KPVRVIGVA 89
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
736-859 4.95e-17

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971  Cd Length: 124  Bit Score: 80.80  E-value: 4.95e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    736 SEERYRLLAENTSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIEQRQFWP-ITYQ 814
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIERRLEGEPEPVsEERR 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*
gi 22299155    815 VCTARGDVLWLETLVKPRYDSQGHVqQLQTTSRDVTSRVQVQMQL 859
Cdd:TIGR00229   81 VRRKDGSEIWVEVSVSPIRTNGGEL-GVVGIVRDITERKEAEEAL 124
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
747-849 5.40e-15

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 74.21  E-value: 5.40e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  747 TSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIEQRQFWPITYQVCTARGDVLWLE 826
Cdd:cd00130    1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                         90       100
                 ....*....|....*....|...
gi 22299155  827 TLVKPRYDSQGHVQQLQTTSRDV 849
Cdd:cd00130   81 VSLTPIRDEGGEVIGLLGVVRDI 103
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
311-460 6.36e-15

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 75.11  E-value: 6.36e-15
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155     311 DLATIFETAVREIAQVgLGVDAAVVQYLPEQGVWRHIAEYHHDPHFPCgEGLEIPDRDNPFAADLKAGNIVIIADSREIT 390
Cdd:smart00065    1 DLEELLQTILEELRQL-LGADRVLIYLVDENDRGELVLVAADGLTLPT-LGIRFPLDEGLAGRVAETGRPLNIPDVEADP 78
                            90       100       110       120       130       140       150
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22299155     391 DPVNQAIAPA-FPGAWLLIPLIVADRVWGSLTLFNYPEPHEWSRTEIDLARAVATQLEVAIYQATLYQQAQ 460
Cdd:smart00065   79 LFAEDLLGRYqGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLAIALANAQLYEELR 149
FhlA COG2203
GAF domain [Signal transduction mechanisms];
295-463 6.83e-15

GAF domain [Signal transduction mechanisms];


Pssm-ID: 225113  Cd Length: 175  Bit Score: 75.40  E-value: 6.83e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  295 REQALNHVIQAIRNSLDLATIFETAVREIAQVgLGVDAAVVQYLPEQGVWRH--IAEYHHDPHFPCGEGLE--IPDRDNP 370
Cdd:COG2203    2 EEALLNELAAKIAQDLDLEEILQAALELLAEL-LGADRGLIYLLDEDGLLDGalVAEAAEAGLEQLIDELFglVILPACL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  371 FAADLKAGNIVIIADSREITDPVNQAIAPAFPG--AWLLIPLIVADRVWGSLTLFNYPEPHEWSRTEIDLARAVATQLEV 448
Cdd:COG2203   81 IGIALREGRPVVVEDILQDPRFRDNPLVLLEPPirSYLGVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAI 160
                        170
                 ....*....|....*
gi 22299155  449 AIYQATLYQQAQQEL 463
Cdd:COG2203  161 AIERARLYEELQEAE 175
GAF pfam01590
GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl ...
311-450 2.78e-12

GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyze ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalyzed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyzes the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.


Pssm-ID: 307634  Cd Length: 133  Bit Score: 66.75  E-value: 2.78e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    311 DLATIFETAVREIAQVgLGVDAAVVQYLPEQGVWRHIAeyhHDPHFPCGEGLEIPDRDnpfAADLKAGNIVIIADSREIT 390
Cdd:pfam01590    1 DLEEILQTILEELREL-LGADRCALYLPDEDGLEYGLP---PGARWLKAAGLEIPPGT---GTVLRTGRPLVVPDAAGDP 73
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 22299155    391 D--PVNQAIAPAFPGAWLLIPLIVADRVWGSLTLFNYPEPheWSRTEIDLARAVATQLEVAI 450
Cdd:pfam01590   74 RflDPLLLLRNFGIRSLLAVPIIDDGELLGVLVLHHPRPP--FTEEELELLEVLADQVAIAL 133
PAS COG2202
PAS domain [Signal transduction mechanisms];
49-292 9.25e-11

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 63.33  E-value: 9.25e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   49 GVALYDVTGEIVYMNPAGRALLGVEDpattasqicADLRIFYCgSDRPYPKDELPGIQALQGLTVPPMELEVQ---YGDR 125
Cdd:COG2202    1 LILVLDRDGRIIYANEAAEELLGYSA---------EELLGLLL-ALHPEDRDRLRELLRRLLAGEELLSEELRlvrKDGE 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  126 QLTVEVQASPILNPAGQVEFSISTfWEITARKRSELEqqilknyWQAQANRYYEILQSQSDLVLCSRADTTITFANDAFC 205
Cdd:COG2202   71 ERWVELSAAPLRDGEGRVLGLLGL-RDITERKRAEEA-------LRESEERLRALLEASPDGIWVLDEDGRILYANPAAE 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  206 QFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQ--LRPDAPTFVNENRVYHPQYGLRWTQWMNTAIFDAEGNLREIQSVG 283
Cdd:COG2202  143 ELLGYSPEEELGRGLSDLIHPEDEERRELELARalAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIA 222

                 ....*....
gi 22299155  284 RDITALKEQ 292
Cdd:COG2202  223 RDITERKQA 231
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
738-804 9.42e-11

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 60.88  E-value: 9.42e-11
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22299155     738 ERYRLLAENTSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIE 804
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQRLLS 67
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
185-286 4.82e-10

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 59.57  E-value: 4.82e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  185 SDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQLRPDAPTFVNENRVYHPQYGLRWTQW 264
Cdd:cd00130    2 PDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLV 81
                         90       100
                 ....*....|....*....|..
gi 22299155  265 MNTAIFDAEGNLREIQSVGRDI 286
Cdd:cd00130   82 SLTPIRDEGGEVIGLLGVVRDI 103
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
175-286 2.83e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 307226  Cd Length: 113  Bit Score: 48.18  E-value: 2.83e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    175 NRYYEILQSQSDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQLRPDAPTFVNENRVYH 254
Cdd:pfam00989    1 EDLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIPEEDDAEVAELLRQALLQGEESRGFEVSFR 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 22299155    255 -PQYGLRWTQWMNTAIFDAEGNLREIQSVGRDI 286
Cdd:pfam00989   81 vPDGRPRHVEVRASPVRDAGGEILGFLGVLRDI 113
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
194-299 1.46e-05

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971  Cd Length: 124  Bit Score: 46.13  E-value: 1.46e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    194 DTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQ-LRPDAPTFVNENRVYHPQYGLRWTQWMNTAIFDA 272
Cdd:TIGR00229   22 EGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIERrLEGEPEPVSEERRVRRKDGSEIWVEVSVSPIRTN 101
                           90       100
                   ....*....|....*....|....*..
gi 22299155    273 eGNLREIQSVGRDITALKEQllrEQAL 299
Cdd:TIGR00229  102 -GGELGVVGIVRDITERKEA---EEAL 124
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
176-239 4.75e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 43.93  E-value: 4.75e-05
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 22299155     176 RYYEILQSQSDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQL 239
Cdd:smart00091    2 RLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQRL 65
PRK13560 PRK13560
hypothetical protein; Provisional
36-290 2.43e-04

hypothetical protein; Provisional


Pssm-ID: 106506  Cd Length: 807  Bit Score: 45.43  E-value: 2.43e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    36 EHYLAAVLSVLPVGVALYDVTGEIV-YMNPAGRALLGVE------------DPATTASQICADLRIFYcGSDRPYPKDEL 102
Cdd:PRK13560  331 EDMLRAIIEAAPIAAIGLDADGNICfVNNNAAERMLGWSaaevmgkplpgmDPELNEEFWCGDFQEWY-PDGRPMAFDAC 409
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   103 PGIQAL-QGLTVPPMELEVQY-GDRQLTVEVQASPILNPAGQVEFSISTFWEITARKrsELEQQILknywqaQANRYYEi 180
Cdd:PRK13560  410 PMAKTIkGGKIFDGQEVLIEReDDGPADCSAYAEPLHDADGNIIGAIALLVDITERK--QVEEQLL------LANLIVE- 480
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   181 lqsQSDLVLCS-RADT--TITFANDAFCQFFSRPASVVIGC-PWSEFVLAEDLPPLLEKVAQL-RPDAPTFVNENRVYHP 255
Cdd:PRK13560  481 ---NSPLVLFRwKAEEgwPVELVSKNITQFGYEPDEFISGKrMFAAIIHPADLEQVAAEVAEFaAQGVDRFEQEYRILGK 557
                         250       260       270
                  ....*....|....*....|....*....|....*
gi 22299155   256 QYGLRWTQWMNTAIFDAEGNLREIQSVGRDITALK 290
Cdd:PRK13560  558 GGAVCWIDDQSAAERDEEGQISHFEGIVIDISERK 592
 
Name Accession Description Interval E-value
PRK10060 PRK10060
RNase II stability modulator; Provisional
848-1284 1.40e-102

RNase II stability modulator; Provisional


Pssm-ID: 236645  Cd Length: 663  Bit Score: 343.20  E-value: 1.40e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   848 DVTSRVQVQMQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNpqfHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFAT 927
Cdd:PRK10060  222 DITEERRAQERLRILANTDSITGLPNRNAIQELIDHAINAADNN---QVGIVYLDLDNFKKVNDAYGHMFGDQLLQDVSL 298
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   928 WLRRLVGNQYTVARFGGDEFVILLTHVPHPQRAiALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRDA 1007
Cdd:PRK10060  299 AILSCLEEDQTLARLGGDEFLVLASHTSQAALE-AMASRILTRLRLPFRIGLIEVYTGCSIGIALAPEHGDDSESLIRSA 377
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1008 DTAMYAAKRQSGRRYAVFDTQMYEQVLERLHLEHDLRQALNQGGLQLLYQPVVHLqSQRLVGMEALVRWQHPERGLVSPA 1087
Cdd:PRK10060  378 DTAMYTAKEGGRGQFCVFSPEMNQRVFEYLWLDTNLRKALENDQLVIHYQPKITW-RGEVRSLEALVRWQSPERGLIPPL 456
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1088 HFIPIAEDTGLIVALDQWALAQACWQLWTWRQQystAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTE 1167
Cdd:PRK10060  457 EFISYAEESGLIVPLGRWVMLDVVRQVAKWRDK---GINLRVAVNVSARQLADQTIFTALKQALQELNFEYCPIDVELTE 533
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1168 RIGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYR 1247
Cdd:PRK10060  534 SCLIENEELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQSFVRDIHKQPVSQSLVRAIVAVAQALNLQ 613
                         410       420       430
                  ....*....|....*....|....*....|....*..
gi 22299155  1248 VIAEGIETPKQLQILQELGCDEGQGYLFARPLPPETF 1284
Cdd:PRK10060  614 VIAEGVETAKEDAFLTKNGVNERQGFLFAKPMPAVAF 650
EAL cd01948
EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1041-1282 5.41e-101

EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.


Pssm-ID: 238923  Cd Length: 240  Bit Score: 323.34  E-value: 5.41e-101
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1041 HDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLWTWRQQ 1120
Cdd:cd01948    1 ADLRRALERGEFELYYQPIVDLRTGRIVGYEALLRWRHPEGGLISPAEFIPLAEETGLIVELGRWVLEEACRQLARWQAG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1121 YstaANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTGY 1200
Cdd:cd01948   81 G---PDLRLSVNLSARQLRDPDFLDRLLELLAETGLPPRRLVLEITESALIDDLEEALATLRRLRALGVRIALDDFGTGY 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1201 SCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPLP 1280
Cdd:cd01948  158 SSLSYLKRLPVDYLKIDRSFVRDIETDPEDRAIVRAIIALAHSLGLKVVAEGVETEEQLELLRELGCDYVQGYLFSRPLP 237

                 ..
gi 22299155 1281 PE 1282
Cdd:cd01948  238 AE 239
EAL COG2200
EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) ...
1036-1291 8.52e-96

EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) [Signal transduction mechanisms];


Pssm-ID: 225110  Cd Length: 256  Bit Score: 309.61  E-value: 8.52e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1036 RLHLEHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLW 1115
Cdd:COG2200    1 RLQLERDLRQALENGEFSLYYQPIVDLATGRIVGYEALLRWRHPDGGLISPGEFIPLAEETGLIVELGRWVLEEACRQLR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1116 TWRQQystaANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDD 1195
Cdd:COG2200   81 TWPRA----GPLRLAVNLSPVQLRSPGLVDLLLRLLARLGLPPHRLVLEITESALIDDLDTALALLRQLRELGVRIALDD 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1196 FGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLF 1275
Cdd:COG2200  157 FGTGYSSLSYLKRLPPDILKIDRSFVRDLETDARDQAIVRAIVALAHKLGLTVVAEGVETEEQLDLLRELGCDYLQGYLF 236
                        250
                 ....*....|....*.
gi 22299155 1276 ARPLPPETFASLFLKP 1291
Cdd:COG2200  237 SRPLPADALDALLSSS 252
EAL smart00052
Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a ...
1040-1283 5.11e-92

Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a variety of bacteria.


Pssm-ID: 214491  Cd Length: 242  Bit Score: 298.36  E-value: 5.11e-92
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    1040 EHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLWTWRQ 1119
Cdd:smart00052    1 ERELRQALENGQFLLYYQPIVSLRTGRLVGVEALIRWQHPEGGIISPDEFIPLAEETGLIVPLGRWVLEQACQQLAEWQA 80
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    1120 QysTAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTG 1199
Cdd:smart00052   81 Q--GPPPLLISINLSARQLISPDLVPRVLELLEETGLPPQRLELEITESVLLDDDESAVATLQRLRELGVRIALDDFGTG 158
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    1200 YSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPL 1279
Cdd:smart00052  159 YSSLSYLKRLPVDLLKIDKSFVRDLQTDPEDEAIVQSIIELAQKLGLQVVAEGVETPEQLDLLRSLGCDYGQGYLFSRPL 238

                    ....
gi 22299155    1280 PPET 1283
Cdd:smart00052  239 PLDD 242
PRK11359 PRK11359
cyclic-di-GMP phosphodiesterase; Provisional
856-1283 4.82e-89

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183097  Cd Length: 799  Bit Score: 308.24  E-value: 4.82e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   856 QMQLHHDAYHDSLTGLPNRLYFMEQLAAAIsqaqtNPQFHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLR-RLVG 934
Cdd:PRK11359  369 RQHIEQLIQFDPLTGLPNRNNLHNYLDDLV-----DKAVSPVVYLIGVDHFQDVIDSLGYAWADQALLEVVNRFReKLKP 443
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   935 NQYtVARFGGDEFViLLTHVPHPQRAIALCEELIHSLQQPLRVGERQIFLSTSIGVvfaqnEYETGM---AVLRDADTAM 1011
Cdd:PRK11359  444 DQY-LCRIEGTQFV-LVSLENDVSNITQIADELRNVVSKPIMIDDKPFPLTLSIGI-----SYDVGKnrdYLLSTAHNAM 516
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1012 YAAKRQSGRRYAVFDTQMYEQVLERLHLEHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIP 1091
Cdd:PRK11359  517 DYIRKNGGNGWQFFSPAMNEMVKERLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIP 596
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1092 IAEDTGLIVALDQWALAQACWQLWTWRQQystAANL-VLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIG 1170
Cdd:PRK11359  597 LAEEIGEIENIGRWVIAEACRQLAEWRSQ---NIHIpALSVNLSALHFRSNQLPNQVSDAMQAWGIDGHQLTVEITESMM 673
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1171 IELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIA 1250
Cdd:PRK11359  674 MEHDTEIFKRIQILRDMGVGLSVDDFGTGFSGLSRLVSLPVTEIKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVA 753
                         410       420       430
                  ....*....|....*....|....*....|...
gi 22299155  1251 EGIETPKQLQILQELGCDEGQGYLFARPLPPET 1283
Cdd:PRK11359  754 EGVETKEQFEMLRKIHCRVIQGYFFSRPLPAEE 786
COG5001 COG5001
Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain ...
835-1282 2.94e-87

Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms];


Pssm-ID: 227334  Cd Length: 663  Bit Score: 299.50  E-value: 2.94e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  835 SQGHVQQLQTTSRDVTSRVQVQMQLHHD--------------AYHDSLTGLPNRLYFMEQLAAAISQAQTNPQfHYAVLF 900
Cdd:COG5001  186 SAGMIVILLTNYREFSDMVQSQVTLTQRaeetrrlsdendrlANLDSLTGLPNRRRFFAELDARLAAARQSGR-RLVLGV 264
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  901 FDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARFGGDEFVILLTHVPHPQRAIALCEELIHSLQQPLRVGER 980
Cdd:COG5001  265 IDLDGFKPVNDAFGHATGDRLLIEVGRRLKAFDGAPILAARLGGDEFALIIPALEDDALRVAGARALCESLQAPYDLRGV 344
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  981 QIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKrQSGRRYAV-FDTQMYEQVLERLHLEHDLRQALNQGGLQLLYQPV 1059
Cdd:COG5001  345 RVQVGASIGIAPFPSGADTSEQLFERADYALYHAK-QNGKGAAVlFDARHEAAIRDMAVVEQALRSADLEQELSVHFQPI 423
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1060 VHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLWTWRQqystaaNLVLSVNVSAKTLQ 1139
Cdd:COG5001  424 VDIVSGKTIALEALARWHSPEIGPVPPDVFIGIAERSGQIVELTRLLLAKALREARAWPM------DVRVSINLSARDLA 497
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1140 DPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLHSLPIQHLKVDRS 1219
Cdd:COG5001  498 SMENVRRLLAIVSESCIAPHRLDFEITETAIVCDFDQARDALAALHELGVRTALDDFGTGYSSLSHLRALPLDKIKIDRS 577
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 22299155 1220 FVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPLPPE 1282
Cdd:COG5001  578 FVSDLEENPTSEDIVRTVLQLGRNLRMECVVEGVETEAQRDRVAALGATVMQGYHYARPMPAE 640
PRK09776 PRK09776
putative diguanylate cyclase; Provisional
463-1285 2.55e-85

putative diguanylate cyclase; Provisional


Pssm-ID: 182070  Cd Length: 1092  Bit Score: 302.75  E-value: 2.55e-85
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   463 LAERRRIE-ATLRQSEECFRLTATNvpGAIFRYIQYPDGR----NRVfylnpMCERLwGVPAEAAAEdgEHLWQLVHPED 537
Cdd:PRK09776  267 VMYAFRAErKHISESETRFRNAMEY--SAIGMALVGTEGQwlqvNKA-----LCQFL-GYSQEELRG--LTFQQLTWPED 336
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   538 REATWQSV--LRSAETLTpWFAQWRIIHpTTGEIRWLEGAGQPTRDADGAVVWH-TVILDVTDRHLAEARLKEQQAQLEL 614
Cdd:PRK09776  337 LNKDLQQVekLLSGEINS-YSMEKRYYR-RDGEVVWALLAVSLVRDTDGTPLYFiAQIEDINELKRTEQVNERLMERITL 414
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   615 AARVSNIGFYFCDLHTGTFYVSPSYKAQLGYPATTqEVNLEDWEERLHPEDRDRALAAYRQFLRGEAHYSIDLRLRHCNG 694
Cdd:PRK09776  415 ANEAGGIGIWEWDLKPNIISWDKRMFELYEIPPHI-KPTWQVWYACLHPEDRQRVEKEIRDALQGRSPFKLEFRIVVKDG 493
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   695 TyRWFHSEAVLIHDEQGQPSKVVGTNVDITERKATELALRESEERYRLLAENTSDIICLLDCQGSCLYVSPSYETLLGWP 774
Cdd:PRK09776  494 V-RHIRALANRVLNKDGEVERLLGINMDMTEVRQLNEALFQEKERLHITLDSIGEAVVCTDMAMKVTFMNPVAEKMTGWT 572
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   775 TETLIGEHFTQLCH-------PE-------ERSRVKQELQQmieqrqfwpityqvctargDVLwLETLVKPRYDSQGHVQ 840
Cdd:PRK09776  573 QEEALGVPLLTVLHitfgdngPLmeniyscLTSRSAAYLEQ-------------------DVV-LHCRSGGSYDVHYSIT 632
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   841 QLQTTS----------RDVTSRVQVQMQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNPQFHyAVLFFDLDRFKVIN 910
Cdd:PRK09776  633 PLSTLDgenigsvlviQDVTESRKMLRQLSYSASHDALTHLANRASFEKQLRRLLQTVNSTHQRH-ALVFIDLDRFKAVN 711
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   911 DSLGHGVGDQVLIAFATWLRRLVGNQYTVARFGGDEFVILLTHVPHPQrAIALCEELIHSLQQPLRVGERQIF-LSTSIG 989
Cdd:PRK09776  712 DSAGHAAGDALLRELASLMLSMLRSSDVLARLGGDEFGLLLPDCNVES-ARFIATRIISAINDYHFPWEGRVYrVGASAG 790
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   990 VVFAQNEYETGMAVLRDADTAMYAAKRqSGR-RYAVfdtqmYEQVLERLHLEHD-------LRQALNQGGLQLLYQPVVH 1061
Cdd:PRK09776  791 ITLIDANNHQASEVMSQADIACYAAKN-AGRgRVTV-----YEPQQAAAHSEHRalslaeqWRMIKENQLMMLAHGVASP 864
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1062 LQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQAcwqlwtWRQQYSTAA--NLVLSVNVSAKTLQ 1139
Cdd:PRK09776  865 RIPEARNHWLISLRLWDPEGEIIDEGAFRPAAEDPALMHALDRRVIHEF------FRQAAKAVAskGLSIALPLSVAGLS 938
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1140 DPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLHSLPIQHLKVDRS 1219
Cdd:PRK09776  939 SPTLLPFLLEQLENSPLPPRLLHLEITETALLNHAESASRLVQKLRLAGCRVVLSDFGRGLSSFNYLKAFMADYLKLDGE 1018
                         810       820       830       840       850       860
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22299155  1220 FVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPLPPETFA 1285
Cdd:PRK09776 1019 LVANLHGNLMDEMLISIIQGHAQRLGMKTIAGPVELPLVLDTLSGIGVDLAYGYAIARPQPLDLLL 1084
EAL pfam00563
EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1042-1278 4.15e-76

EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.


Pssm-ID: 306937  Cd Length: 235  Bit Score: 253.78  E-value: 4.15e-76
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   1042 DLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLwtwrQQY 1121
Cdd:pfam00563    3 ALRQALENGEFILYYQPIVDLRTGRVVGYEALLRWQHPDGGLISPDRFLPLAERLGLIAELDRWVLEQVLADL----RRL 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   1122 STAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTGYS 1201
Cdd:pfam00563   79 ALDPDIKLSINLSPASLADPSFLERLRELLKQSGPPPSRLVLEITESDLLARLEALQELLARLRALGIRIALDDFGTGYS 158
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22299155   1202 CLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARP 1278
Cdd:pfam00563  159 SLSYLRRLPPDFIKIDRSLIRDIDKDPEAQAIVRALIALARELGIKVVAEGVETEEQLEALKELGCDLVQGYYFSKP 235
PRK13561 PRK13561
putative diguanylate cyclase; Provisional
852-1291 5.20e-76

putative diguanylate cyclase; Provisional


Pssm-ID: 184143  Cd Length: 651  Bit Score: 266.96  E-value: 5.20e-76
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   852 RVQVQMQLHHD-----AYHDSLTGLPNRLYFMEQLAAAISQAQTnpqfhYAVLFFDLDRFKVINDSLGHGVGDQVLIAFA 926
Cdd:PRK13561  215 LNQQLLQRQYEeqsrnATRFPVSDLPNKALLMALLEQVVARKQT-----TALMIITCETLRDTAGVLKEAQREILLLTLV 289
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   927 TWLRRLVGNQYTVARFGGDEFVILLTHVPHPQRAIALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEyETGMAVLRD 1006
Cdd:PRK13561  290 EKLKSVLSPRMVLAQISGYDFAIIANGVKEPWHAITLGQQVLTIINERLPIQRIQLRPSCSIGIAMFYGD-LTAEQLYSR 368
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1007 ADTAMYAAKRQSGRRYAVFDTQMYEQVLERLHLEHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSP 1086
Cdd:PRK13561  369 AISAAFTARRKGKNQIQFFDPQQMEAAQKRLTEESDILNALENHQFAIWLQPQVEMRSGKLVSAEALLRMQQPDGSWDLP 448
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1087 AHFIPIAEDTGLIVALDQWALAQACWQLWTWRQQystAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELT 1166
Cdd:PRK13561  449 EGLIDRIESCGLMVTVGHWVLEESCRLLAAWQER---GIMLPLSVNLSALQLMHPNMVADMLELLTRYRIQPGTLILEVT 525
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1167 ERIGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLH---SLPIQHLKVDRSFVSQLEENErnlQIIRMILLLSKQ 1243
Cdd:PRK13561  526 ESRRIDDPHAAVAILRPLRNAGVRVALDDFGMGYAGLRQLQhmkSLPIDVLKIDKMFVDGLPEDD---SMVAAIIMLAQS 602
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*...
gi 22299155  1244 LGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPLPPETFASLFLKP 1291
Cdd:PRK13561  603 LNLQVIAEGVETEAQRDWLLKAGVGIAQGFLFARALPIEIFEERYLEE 650
PRK11829 PRK11829
biofilm formation regulator HmsP; Provisional
858-1284 4.68e-74

biofilm formation regulator HmsP; Provisional


Pssm-ID: 183329  Cd Length: 660  Bit Score: 261.41  E-value: 4.68e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   858 QLHHDAYHD--------SLTGLPNRLYFMEQLAAAI-SQAQTNpqfHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATW 928
Cdd:PRK11829  219 QLLADAYADmgrishrfPVTELPNRSLFISLLEKEIaSSTRTD---HFHLLVIGIETLQEVSGAMSEAQHQQLLLTIVQR 295
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   929 LRRLVGNQYTVARFGGDEFVILLTHVPHPQRAIALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRDAD 1008
Cdd:PRK11829  296 IEQCIDDSDLLAQLSKTEFAVLARGTRRSFPAMQLARRIMSQVTQPLFFDEITLRPSASIGITRYQAQQDTAESMMRNAS 375
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1009 TAMYAAKRQSGRRYAVFDTQMYEQVLERLHLEHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAH 1088
Cdd:PRK11829  376 TAMMAAHHEGRNQIMVFEPHLIEKTHKRLTQENDLLQAIENHDFTLFLQPQWDMKRQQVIGAEALLRWCQPDGSYVLPSG 455
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1089 FIPIAEDTGLIVALDQWALAQACWQLWTWRQQystAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTER 1168
Cdd:PRK11829  456 FVHFAEEEGMMVPLGNWVLEEACRILADWKAR---GVSLPLSVNISGLQVQNKQFLPHLKTLISHYHIDPQQLLLEITET 532
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1169 IGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLH---SLPIQHLKVDRSFVSQLEENErnlQIIRMILLLSKQLG 1245
Cdd:PRK11829  533 AQIQDLDEALRLLRELQGLGLLIALDDFGIGYSSLRYLNhlkSLPIHMIKLDKSFVKNLPEDD---AIARIISCVSDVLK 609
                         410       420       430
                  ....*....|....*....|....*....|....*....
gi 22299155  1246 YRVIAEGIETPKQLQILQELGCDEGQGYLFARPLPPETF 1284
Cdd:PRK11829  610 VRVMAEGVETEEQRQWLLEHGIQCGQGFLFSPPLPRAEF 648
GGDEF cd01949
Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: ...
864-1023 1.64e-57

Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.


Pssm-ID: 143635  Cd Length: 158  Bit Score: 198.16  E-value: 1.64e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  864 YHDSLTGLPNRLYFMEQLAAAISQAQTNPQfHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARFG 943
Cdd:cd01949    1 YTDPLTGLPNRRAFEERLERLLARARRSGR-PLALLLIDIDHFKQINDTYGHAAGDEVLKEVAERLRSSLRESDLVARLG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  944 GDEFVILLTHVpHPQRAIALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKRQSGRRYA 1023
Cdd:cd01949   80 GDEFAILLPGT-DLEEAEALAERLREAIEEPFFIDGQEIRVTASIGIATYPEDGEDAEELLRRADEALYRAKRSGRNRVV 158
YjcC COG4943
Environmental sensor c-di-GMP phosphodiesterase, contains periplasmic CSS-motif sensor and ...
1036-1284 3.13e-57

Environmental sensor c-di-GMP phosphodiesterase, contains periplasmic CSS-motif sensor and cytoplasmic EAL domain [Signal transduction mechanisms];


Pssm-ID: 227279  Cd Length: 524  Bit Score: 209.21  E-value: 3.13e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1036 RLHLEHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQWALAQACWQLW 1115
Cdd:COG4943  266 YLSPRRRLQRAIERRELCVHYQPIVDLATGKCVGAEALARWPQEDGTVVSPDVFIPLAEESGMIEQITDYVIRNVFRDLG 345
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1116 TWRQQYstaANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIELGSeMLSLLESLRHRHVEISIDD 1195
Cdd:COG4943  346 DLLRQH---RDLHVSINLSASDLASPRLIDRLNRKLAQYQVRPQQIALELTERTFADPKK-MTPIILRLREAGHEIYIDD 421
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1196 FGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLF 1275
Cdd:COG4943  422 FGTGYSNLHYLQSLPVDALKIDKSFVDTLGTDSASHLIAPHIIEMAKSLGLKIVAEGVETEEQVDWLRKRGVHYGQGWLF 501

                 ....*....
gi 22299155 1276 ARPLPPETF 1284
Cdd:COG4943  502 SKALPAQAF 510
GGDEF COG2199
GGDEF domain, diguanylate cyclase (c-di-GMP synthetase) or its enzymatically inactive variants ...
847-1025 1.03e-53

GGDEF domain, diguanylate cyclase (c-di-GMP synthetase) or its enzymatically inactive variants [Signal transduction mechanisms];


Pssm-ID: 225109  Cd Length: 181  Bit Score: 188.43  E-value: 1.03e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  847 RDVTSRVQVQMQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNPQfHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFA 926
Cdd:COG2199    4 RLLTRLRKAEERLERLALHDPLTGLPNRRAFEERLERALARARRHGE-PLALLLLDLDHFKQINDTYGHAAGDEVLREVA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  927 TWLRRLVGNQYTVARFGGDEFVILLTHVPHPQrAIALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRD 1006
Cdd:COG2199   83 RRLRSNLREGDLVARLGGDEFAVLLPGTSLEE-AARLAERIRAALEEPFFLGGEELRVTVSIGVALYPEDGSDDAELLLR 161
                        170       180
                 ....*....|....*....|
gi 22299155 1007 -ADTAMYAAKRQSGRRYAVF 1025
Cdd:COG2199  162 rADLALYRAKRAGRNRVVVF 181
GGDEF pfam00990
Diguanylate cyclase, GGDEF domain; This domain is found linked to a wide range of ...
863-1020 1.67e-51

Diguanylate cyclase, GGDEF domain; This domain is found linked to a wide range of non-homologous domains in a variety of bacteria. It has been shown to be homologous to the adenylyl cyclase catalytic domain and has diguanylate cyclase activity. This observation correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. In the WspR protein of Pseudomonas aeruginosa, the GGDEF domain acts as a diguanylate cyclase, Structure 3bre, when the whole molecule appears to form a tetramer consisting of two symmetrically-related dimers representing a biological unit. The active site is the GGD/EF motif, buried in the structure, and the cyclic dimeric guanosine monophosphate (c-di-GMP) bind to the inhibitory-motif RxxD on the surface. The enzyme thus catalyzes the cyclisation of two guanosine triphosphate (GTP) molecules to one c-di-GMP molecule.


Pssm-ID: 307227  Cd Length: 160  Bit Score: 181.29  E-value: 1.67e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    863 AYHDSLTGLPNRLYFMEQLAAAISQAQTnPQFHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARF 942
Cdd:pfam00990    1 AAHDPLTGLPNRRYFEEELEQELQRALR-EGSPLAVLLIDLDNFKRINDTYGHSVGDEVLQEVAQRLSSSLRRSDLVARL 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    943 GGDEFVILLTHVPHP--QRAIALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKRQsGR 1020
Cdd:pfam00990   80 GGDEFAILLPETNLEgaAELAERIRRLLAKLKIPHTLSGLPLYVTISIGIAAYPNDGEDPEDLIKRADTALYQAKQA-GR 158
GGDEF smart00267
diguanylate cyclase; Diguanylate cyclase, present in a variety of bacteria.
861-1025 2.56e-51

diguanylate cyclase; Diguanylate cyclase, present in a variety of bacteria.


Pssm-ID: 128563  Cd Length: 163  Bit Score: 180.91  E-value: 2.56e-51
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155     861 HDAYHDSLTGLPNRLYFMEQLAAAISQAQTNPQFHyAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVA 940
Cdd:smart00267    1 RLAFRDPLTGLPNRRYFEEELEQELQRAQRQGSPF-ALLLIDLDNFKDINDTYGHAVGDELLQEVAQRLSSCLRPGDLLA 79
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155     941 RFGGDEFVILLTHVPHpQRAIALCEELIHSLQQPLRVGERQIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKRQSGR 1020
Cdd:smart00267   80 RLGGDEFALLLPETSL-EEAIALAERILQQLREPIIIHGIPLYLTISIGVAAYPNPGEDAEDLLKRADTALYQAKKAGRN 158

                    ....*
gi 22299155    1021 RYAVF 1025
Cdd:smart00267  159 QVAVY 163
PRK10551 PRK10551
phage resistance protein; Provisional
1036-1291 4.25e-45

phage resistance protein; Provisional


Pssm-ID: 182541  Cd Length: 518  Bit Score: 173.25  E-value: 4.25e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1036 RLHLEHDLRQALNQGGLQLLYQPVVHLQSQRLVGMEALVRWQHPERGLVSPAHFIPIAEDTGLIVALDQ--WAL-AQACW 1112
Cdd:PRK10551  261 RMRPGKEILTGIKRGQFYVEYQPVVDTQTLRVTGLEALLRWRHPTAGEIPPDAFINYAEAQKLIVPLTQhlFELiARDAA 340
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1113 QLwtwrqQYSTAANLVLSVNVSAKTLQDPTFLQHLDTIRQRYPLPKGQLLLELTERIGIElGSEMLSLLESLRHRHVEIS 1192
Cdd:PRK10551  341 EL-----QKVLPVGAKLGINISPAHLHSDSFKADVQRLLASLPADHFQIVLEITERDMVQ-EEEATKLFAWLHSQGIEIA 414
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1193 IDDFGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQG 1272
Cdd:PRK10551  415 IDDFGTGHSALIYLERFTLDYLKIDRGFIQAIGTETVTSPVLDAVLTLAKRLNMLTVAEGVETPEQARWLRERGVNFLQG 494
                         250
                  ....*....|....*....
gi 22299155  1273 YLFARPLPPETFASLFLKP 1291
Cdd:PRK10551  495 YWISRPLPLEDFVRWLKEP 513
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
828-1026 2.23e-35

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229  Cd Length: 435  Bit Score: 142.08  E-value: 2.23e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  828 LVKPrYDSQGHVQQLQTTSRdvTSRVQVQ-----MQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNpQFHYAVLFFD 902
Cdd:COG3706  233 ITKP-IEEGELRARLRRQLR--RKRYERQlreslERLQELALVDGLTGLFNRRYFDEHLADLWKRALRE-GRPLSLLMLD 308
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  903 LDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARFGGDEFVILLTHVpHPQRAIALCEEL---IHSLQQPLRVGE 979
Cdd:COG3706  309 IDDFKEINDTYGHDVGDEVLRQVARRLRQTVRGLDLVARYGGEEFAVVLPDT-DLEAAIAIAERIrqkINELPFVHELSR 387
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 22299155  980 RQIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKRqSGR-RYAVFD 1026
Cdd:COG3706  388 EPLEVTISIGVAEGKPGEDSIEELLKRADKALYKAKA-SGRnRVVVKR 434
GGDEF TIGR00254
diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by ...
863-1026 1.09e-32

diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by many proteins carrying the domain. There is evidence that the domain has diguanylate cyclase activity. Several proteins carrying this domain also carry domains with functions relating to environmental sensing. These include PleD, a response regulator protein involved in the swarmer-to-stalked cell transition in Caulobacter crescentus, and FixL, a heme-containing oxygen sensor protein. [Regulatory functions, Small molecule interactions, Signal transduction, Other]


Pssm-ID: 272984  Cd Length: 165  Bit Score: 127.45  E-value: 1.09e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    863 AYHDSLTGLPNRLYFMEQLAAAISQAQTNpQFHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARF 942
Cdd:TIGR00254    2 AVRDPLTGLYNRRYLEEMLDSELKRARRF-QRSFSVLMIDIDNFKKINDTLGHDVGDEVLREVARILQSSVRGSDVVGRY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    943 GGDEFVILLTHVPHPQrAIALCEELIHSL-QQPLRVGER-QIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKrQSGR 1020
Cdd:TIGR00254   81 GGEEFVVILPGTPLED-ALSKAERLRDAInSKPIEVAGSeTLTVTVSIGVACYPGHGLTLEELLKRADEALYQAK-KAGR 158

                   ....*..
gi 22299155   1021 -RYAVFD 1026
Cdd:TIGR00254  159 nRVVVAD 165
PRK11059 PRK11059
regulatory protein CsrD; Provisional
863-1280 8.07e-28

regulatory protein CsrD; Provisional


Pssm-ID: 236833  Cd Length: 640  Bit Score: 120.74  E-value: 8.07e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   863 AYHDSLTGLPNRLYFMEQLAAAiSQAQTNPQFHYAVLFFDLDRFKVINDSLGHGVGDQVLIA----FATWLRRLVGNqyT 938
Cdd:PRK11059  228 AFQDAKTGLGNRLFFDNQLATL-LEDQEMVGAHGVVMLIRLPDFDLLQEEWGESQVEELLFElinlLSTFVMRYPGA--L 304
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   939 VARFGGDEFVILLthvphPQR----AIALCEELIHSL--QQPLRVGERQIFLStsIGVVFAQNEyETGMAVLRDADTAMY 1012
Cdd:PRK11059  305 LARYSRSDFAVLL-----PHRslkeADSLASQLLKAVdaLPPPKMLDRDDFLH--IGICAYRSG-QSTEQVMEEAEMALR 376
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1013 AAKRQSGRRYAVFDTQMYEQ-----VLERLHLEhdlrQALNQGGLQLLYQPVVHLQSQRLvGMEALVRWQHPERGLVSPA 1087
Cdd:PRK11059  377 SAQLQGGNGWFVYDKAQLPEkgrgsVRWRTLLE----QTLVRGGPRLYQQPAVTRDGKVH-HRELFCRIRDGQGELLSAE 451
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1088 HFIPIAEDTGLIVALDQWALAQACWQLWTWRQQystaanlVLSVNVSAKTLQDPTFLQHL-DTIRQrypLPKGQ---LLL 1163
Cdd:PRK11059  452 LFMPMVQQLGLSEQYDRQVIERVLPLLRYWPEE-------NLSINLSVDSLLSRAFQRWLrDTLLQ---CPRSQrkrLIF 521
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1164 ELTERIGIELGSEMLSLLESLRHRHVEISIDDFGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQ 1243
Cdd:PRK11059  522 ELAEADVCQHISRLRPVLRMLRGLGCRLAVDQAGLTVVSTSYIKELNVELIKLHPSLVRNIHKRTENQLFVRSLVGACAG 601
                         410       420       430
                  ....*....|....*....|....*....|....*..
gi 22299155  1244 LGYRVIAEGIETPKQLQILQELGCDEGQGYLFARPLP 1280
Cdd:PRK11059  602 TETQVFATGVESREEWQTLQELGVSGGQGDFFAESQP 638
PRK13560 PRK13560
hypothetical protein; Provisional
466-859 2.76e-25

hypothetical protein; Provisional


Pssm-ID: 106506  Cd Length: 807  Bit Score: 113.23  E-value: 2.76e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   466 RRRIEATLRQS-EECFRLTATNVPGAIFRYIQYPDGRNRVFYLNPMCERLWGVPAEAAAEDGEHLWQLVHPEDREATWQS 544
Cdd:PRK13560   55 RAIAEAEAQDCrEQCERNLKANIPGGMFLFALDGDGTFSFPSLLDANGELAAIAKHDLMADKGLLAMLIGGDDGDFFFAN 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   545 VLRSAETLTPWFAQ--WR--IIHPTTGEIRWLEGAGQPTRDADGAVVWHTVILDVTDRHLAEARLKEQQAQLELAARVSN 620
Cdd:PRK13560  135 PFRSAETIAMALQSddWQeeEGHFRCGDGRFIDCCLRFERHAHADDQVDGFAEDITERKRAEERIDEALHFLQQLLDNIA 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   621 IGFYFCDLHTGTFYVSPSYKAQLGY--------------PATTQEVNLE-DWeERLHPeDRDRALAAYRQfLRGEAHYSI 685
Cdd:PRK13560  215 DPAFWKDEDAKVFGCNDAACLACGFrreeiigmsihdfaPAQPADDYQEaDA-AKFDA-DGSQIIEAEFQ-NKDGRTRPV 291
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   686 DLRLRHcngtyrwfhseaVLIHDEQGQPSKVVGTNVDITERKATELALRESEERYRLLAENTSDIICLLDCQGS-CLYVS 764
Cdd:PRK13560  292 DVIFNH------------AEFDDKENHCAGLVGAITDISGRRAAERELLEKEDMLRAIIEAAPIAAIGLDADGNiCFVNN 359
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   765 PSYETLLGWPTETLIGEHFTQLcHPEERSRVK----QELQQMIEQRQFWPITYQVCTARGDVL-WLETLV---------- 829
Cdd:PRK13560  360 NAAERMLGWSAAEVMGKPLPGM-DPELNEEFWcgdfQEWYPDGRPMAFDACPMAKTIKGGKIFdGQEVLIereddgpadc 438
                         410       420       430
                  ....*....|....*....|....*....|....
gi 22299155   830 ----KPRYDSQGHVQQLQTTSRDVTSRVQVQMQL 859
Cdd:PRK13560  439 sayaEPLHDADGNIIGAIALLVDITERKQVEEQL 472
pleD PRK09581
response regulator PleD; Reviewed
866-1020 2.95e-25

response regulator PleD; Reviewed


Pssm-ID: 236577  Cd Length: 457  Bit Score: 110.76  E-value: 2.95e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   866 DSLTGLPNRLYFMEQLAAAISQAQTNPQfHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARFGGD 945
Cdd:PRK09581  295 DGLTGLHNRRYFDMHLKNLIERANERGK-PLSLMMIDIDHFKKVNDTYGHDAGDEVLREFAKRLRNNIRGTDLIARYGGE 373
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22299155   946 EFVILLTHVPhPQRAIALCEEL-IHSLQQPLRV--GERQIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKrQSGR 1020
Cdd:PRK09581  374 EFVVVMPDTD-IEDAIAVAERIrRKIAEEPFIIsdGKERLNVTVSIGVAELRPSGDTIEALIKRADKALYEAK-NTGR 449
PRK09894 PRK09894
diguanylate cyclase; Provisional
866-1026 3.92e-22

diguanylate cyclase; Provisional


Pssm-ID: 182133  Cd Length: 296  Bit Score: 99.37  E-value: 3.92e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   866 DSLTGLPNRLYFMEQLAAAISQAQTNPqfhYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARFGGD 945
Cdd:PRK09894  132 DVLTGLPGRRVLDESFDHQLRNREPQN---LYLALLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGE 208
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   946 EFVILL-THVPHPQRAIA--LCEELihsLQQPLRVGERQIFLSTSIGVVFAQNEyETGMAVLRDADTAMYAAKRqSGRRY 1022
Cdd:PRK09894  209 EFIICLkAATDEEACRAGerIRQLI---ANHAITHSDGRINITATFGVSRAFPE-ETLDVVIGRADRAMYEGKQ-TGRNR 283

                  ....
gi 22299155  1023 AVFD 1026
Cdd:PRK09894  284 VMFI 287
PAS COG2202
PAS domain [Signal transduction mechanisms];
494-730 2.70e-20

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 92.99  E-value: 2.70e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  494 YIQYPDGRNRVFYLNPMCERLWGVpaeaAAEDGEHLWQLVHPEDREATWQSVLRSAETLTPWFAQWRIIHPTtGEIRWLE 573
Cdd:COG2202    1 LILVLDRDGRIIYANEAAEELLGY----SAEELLGLLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKD-GEERWVE 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  574 GAGQPTRDADGAVVWHTVILDVTDRHLAEARLKEQQAQLELAARVSNIGFYFCDLHTGTFYVSPSYKAQLGYPATTQEVN 653
Cdd:COG2202   76 LSAAPLRDGEGRVLGLLGLRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGR 155
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22299155  654 LEDWEERLHPEDRDRALAAYRQFLRGEAHYSIDLRLRHCNGTYRWFHSEAVLIHDEQGQPSKVVGTNVDITERKATE 730
Cdd:COG2202  156 GLSDLIHPEDEERRELELARALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
PRK09966 PRK09966
putative inner membrane diguanylate cyclase; Provisional
852-1021 3.37e-20

putative inner membrane diguanylate cyclase; Provisional


Pssm-ID: 182171  Cd Length: 407  Bit Score: 94.69  E-value: 3.37e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   852 RVQVQ-MQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNPQfhYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLR 930
Cdd:PRK09966  236 RLQAKnAQLLRTALHDPLTGLANRAAFRSGINTLMNNSDARKT--SALLFLDGDNFKYINDTWGHATGDRVLIEIAKRLA 313
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   931 RLVGNQYTVARFGGDEFVILLTHVPHPQRAIALCEELIHSLQQPLRVGE-RQIFLSTSIGvvFAQN-EYETGMAVLRDAD 1008
Cdd:PRK09966  314 EFGGLRHKAYRLGGDEFAMVLYDVQSESEVQQICSALTQIFNLPFDLHNgHQTTMTLSIG--YAMTiEHASAEKLQELAD 391
                         170
                  ....*....|...
gi 22299155  1009 TAMYAAKRQSGRR 1021
Cdd:PRK09966  392 HNMYQAKHQRAEK 404
PAS COG2202
PAS domain [Signal transduction mechanisms];
622-856 8.39e-20

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 91.45  E-value: 8.39e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  622 GFYFCDLHTGTFYVSPSYKAQLGYpattQEVNLEDWEERLHPEDRDRALAAYRQFLRGEAHYSIDLRLRHCNGTYRWFHS 701
Cdd:COG2202    1 LILVLDRDGRIIYANEAAEELLGY----SAEELLGLLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVEL 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  702 EAVLIHDEQGQPSKVVGTNvDITERKATELALRESEERYRLLAENTSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGE 781
Cdd:COG2202   77 SAAPLRDGEGRVLGLLGLR-DITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGR 155
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22299155  782 HFTQLCHPEERSRVKQELQQMI--EQRQFWPITYQVCTARGDVLWLETLVKPRYDSQGHVQQLQTTSRDVTSRVQVQ 856
Cdd:COG2202  156 GLSDLIHPEDEERRELELARALaeGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
634-720 5.28e-18

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312074  Cd Length: 89  Bit Score: 82.39  E-value: 5.28e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    634 YVSPSYKAQLGYpaTTQEV--NLEDWEERLHPEDRDRALAAYRQFLRGEAHYSIDLRLRHCNGTYRWFHSEAVLIHDEQG 711
Cdd:pfam08447    3 YWSPRFEEILGY--TPEELlgKGESWLDLVHPDDRERVREALWEALKGGEPYSGEYRIRRKDGEYRWVEARARPIRDENG 80

                   ....*....
gi 22299155    712 QPSKVVGTN 720
Cdd:pfam08447   81 KPVRVIGVA 89
PRK15426 PRK15426
putative diguanylate cyclase YedQ; Provisional
856-1026 8.94e-18

putative diguanylate cyclase YedQ; Provisional


Pssm-ID: 237964  Cd Length: 570  Bit Score: 88.53  E-value: 8.94e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   856 QMQLHHDAYHDSLTGLPNRLYFMEQLAAAISQAQTNpQFHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGN 935
Cdd:PRK15426  391 QSSLQWQAWHDPLTRLYNRGALFEKARALAKRCQRD-QQPFSVIQLDLDHFKSINDRFGHQAGDRVLSHAAGLISSSLRA 469
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   936 QYTVARFGGDEFVILLTHVPHPQrAIALCEELihslqqPLRVGERQIFL--------STSIGVVFAQneyETGM----AV 1003
Cdd:PRK15426  470 QDVAGRVGGEEFCVVLPGASLAE-AAQVAERI------RLRINEKEILVaksttiriSASLGVSSAE---EDGDydfeQL 539
                         170       180
                  ....*....|....*....|...
gi 22299155  1004 LRDADTAMYAAKrQSGRRYAVFD 1026
Cdd:PRK15426  540 QSLADRRLYLAK-QAGRNRVCAS 561
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
736-859 4.95e-17

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971  Cd Length: 124  Bit Score: 80.80  E-value: 4.95e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    736 SEERYRLLAENTSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIEQRQFWP-ITYQ 814
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIERRLEGEPEPVsEERR 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*
gi 22299155    815 VCTARGDVLWLETLVKPRYDSQGHVqQLQTTSRDVTSRVQVQMQL 859
Cdd:TIGR00229   81 VRRKDGSEIWVEVSVSPIRTNGGEL-GVVGIVRDITERKEAEEAL 124
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
747-849 5.40e-15

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 74.21  E-value: 5.40e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  747 TSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIEQRQFWPITYQVCTARGDVLWLE 826
Cdd:cd00130    1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                         90       100
                 ....*....|....*....|...
gi 22299155  827 TLVKPRYDSQGHVQQLQTTSRDV 849
Cdd:cd00130   81 VSLTPIRDEGGEVIGLLGVVRDI 103
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
311-460 6.36e-15

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 75.11  E-value: 6.36e-15
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155     311 DLATIFETAVREIAQVgLGVDAAVVQYLPEQGVWRHIAEYHHDPHFPCgEGLEIPDRDNPFAADLKAGNIVIIADSREIT 390
Cdd:smart00065    1 DLEELLQTILEELRQL-LGADRVLIYLVDENDRGELVLVAADGLTLPT-LGIRFPLDEGLAGRVAETGRPLNIPDVEADP 78
                            90       100       110       120       130       140       150
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22299155     391 DPVNQAIAPA-FPGAWLLIPLIVADRVWGSLTLFNYPEPHEWSRTEIDLARAVATQLEVAIYQATLYQQAQ 460
Cdd:smart00065   79 LFAEDLLGRYqGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLAIALANAQLYEELR 149
FhlA COG2203
GAF domain [Signal transduction mechanisms];
295-463 6.83e-15

GAF domain [Signal transduction mechanisms];


Pssm-ID: 225113  Cd Length: 175  Bit Score: 75.40  E-value: 6.83e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  295 REQALNHVIQAIRNSLDLATIFETAVREIAQVgLGVDAAVVQYLPEQGVWRH--IAEYHHDPHFPCGEGLE--IPDRDNP 370
Cdd:COG2203    2 EEALLNELAAKIAQDLDLEEILQAALELLAEL-LGADRGLIYLLDEDGLLDGalVAEAAEAGLEQLIDELFglVILPACL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  371 FAADLKAGNIVIIADSREITDPVNQAIAPAFPG--AWLLIPLIVADRVWGSLTLFNYPEPHEWSRTEIDLARAVATQLEV 448
Cdd:COG2203   81 IGIALREGRPVVVEDILQDPRFRDNPLVLLEPPirSYLGVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAI 160
                        170
                 ....*....|....*
gi 22299155  449 AIYQATLYQQAQQEL 463
Cdd:COG2203  161 AIERARLYEELQEAE 175
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
738-849 1.18e-13

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 307226  Cd Length: 113  Bit Score: 70.52  E-value: 1.18e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    738 ERYRLLAENTSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIEQRQFWpITYQVC- 816
Cdd:pfam00989    1 EDLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIPEEDDAEVAELLRQALLQGEES-RGFEVSf 79
                           90       100       110
                   ....*....|....*....|....*....|....
gi 22299155    817 -TARGDVLWLETLVKPRYDSQGHVQQLQTTSRDV 849
Cdd:pfam00989   80 rVPDGRPRHVEVRASPVRDAGGEILGFLGVLRDI 113
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
761-845 2.14e-13

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312074  Cd Length: 89  Bit Score: 69.29  E-value: 2.14e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    761 LYVSPSYETLLGWPTETLIG--EHFTQLCHPEERSRVKQELQQMIEQRQFWPITYQVCTARGDVLWLETLVKPRYDSQGH 838
Cdd:pfam08447    2 IYWSPRFEEILGYTPEELLGkgESWLDLVHPDDRERVREALWEALKGGEPYSGEYRIRRKDGEYRWVEARARPIRDENGK 81

                   ....*..
gi 22299155    839 VQQLQTT 845
Cdd:pfam08447   82 PVRVIGV 88
adrA PRK10245
diguanylate cyclase AdrA; Provisional
866-1020 1.75e-12

diguanylate cyclase AdrA; Provisional


Pssm-ID: 182329  Cd Length: 366  Bit Score: 70.63  E-value: 1.75e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   866 DSLTGLPNRLYFmEQLAAAISQAQTNPQFHYAVLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVGNQYTVARFGGD 945
Cdd:PRK10245  208 DGMTGVYNRRHW-ETLLRNEFDNCRRHHRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGD 286
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22299155   946 EFVILLTHVPhPQRAIALCEElIHSLQQPLRV-GERQIFLSTSIGVVFAQNEYETGMAVLRDADTAMYAAKrQSGR 1020
Cdd:PRK10245  287 EFAVIMSGTP-AESAITAMSR-VHEGLNTLRLpNAPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAK-NAGR 359
GAF pfam01590
GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl ...
311-450 2.78e-12

GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyze ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalyzed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyzes the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.


Pssm-ID: 307634  Cd Length: 133  Bit Score: 66.75  E-value: 2.78e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    311 DLATIFETAVREIAQVgLGVDAAVVQYLPEQGVWRHIAeyhHDPHFPCGEGLEIPDRDnpfAADLKAGNIVIIADSREIT 390
Cdd:pfam01590    1 DLEEILQTILEELREL-LGADRCALYLPDEDGLEYGLP---PGARWLKAAGLEIPPGT---GTVLRTGRPLVVPDAAGDP 73
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 22299155    391 D--PVNQAIAPAFPGAWLLIPLIVADRVWGSLTLFNYPEPheWSRTEIDLARAVATQLEVAI 450
Cdd:pfam01590   74 RflDPLLLLRNFGIRSLLAVPIIDDGELLGVLVLHHPRPP--FTEEELELLEVLADQVAIAL 133
PRK11596 PRK11596
cyclic-di-GMP phosphodiesterase; Provisional
1029-1287 6.99e-12

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183222  Cd Length: 255  Bit Score: 66.95  E-value: 6.99e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1029 MYEQVLERLHLEHDLRQALNQGGLQL------LYQPVVHLqSQRLVGMEALVRWQHPE--RGLVSPAH-FIPIAEDTGLI 1099
Cdd:PRK11596    1 MIRQVIQRISLPEASIESLQERRYWLqcerayTFQPIYRT-SGRLMAIELLTAVTHPSnpSQRLSPERyFAEITVSHRLD 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1100 VALDQWALaqacwqLWTWRQQYsTAANLVLSVNVSAKTLQdpTFLQHLDTIRQRYPLPkgQLLLELTERIGIELGSEMLS 1179
Cdd:PRK11596   80 VVKEQLDL------LAQWADFF-VRHGLLASVNIDGPTLI--ALRQQPAILRLIERLP--WLRFELVEHIRLPKDSPFAS 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  1180 LLESLRhrhveISIDDFGTGYSCLSYLHSLPIQHLKVDRSFVSQLEENERNLQIIRMILLLSKQLGYRVIAEGIETPKQL 1259
Cdd:PRK11596  149 MCEFGP-----LWLDDFGTGMANFSALSEVRYDYIKVARELFIMLRQSEEGRNLFSQLLHLMNRYCRGVIVEGVETPEEW 223
                         250       260
                  ....*....|....*....|....*...
gi 22299155  1260 QILQELGCDEGQGYLFARPLPPETFASL 1287
Cdd:PRK11596  224 RDVQRSPAFAAQGYFLSRPAPFETLETL 251
PRK13560 PRK13560
hypothetical protein; Provisional
451-762 7.10e-12

hypothetical protein; Provisional


Pssm-ID: 106506  Cd Length: 807  Bit Score: 69.70  E-value: 7.10e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   451 YQATLYQQAQQELAERRRIEATLRQSEECFRLTATNVPGAIfrYIQYPDGrNRVFYLNPMCERLWGvpAEAAAEDGEHLW 530
Cdd:PRK13560  305 NHCAGLVGAITDISGRRAAERELLEKEDMLRAIIEAAPIAA--IGLDADG-NICFVNNNAAERMLG--WSAAEVMGKPLP 379
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   531 QLvHPEDREATWQSVLR-----------SAETLTPWFAQWRI-------IHPTTGEIRWLEGAGQPTRDADGAVVWH-TV 591
Cdd:PRK13560  380 GM-DPELNEEFWCGDFQewypdgrpmafDACPMAKTIKGGKIfdgqevlIEREDDGPADCSAYAEPLHDADGNIIGAiAL 458
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   592 ILDVTDRHLAEarlkEQQAQLELAARVSNIGFYfcdlhtgtfyvspSYKAQLGYPATTQEVNLEDW----EERL------ 661
Cdd:PRK13560  459 LVDITERKQVE----EQLLLANLIVENSPLVLF-------------RWKAEEGWPVELVSKNITQFgyepDEFIsgkrmf 521
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   662 ----HPEDRDRALAAYRQFL-RGEAHYSIDLRLRHCNGTYRWFHSEAVLIHDEQGQPSKVVGTNVDITERKATELALRES 736
Cdd:PRK13560  522 aaiiHPADLEQVAAEVAEFAaQGVDRFEQEYRILGKGGAVCWIDDQSAAERDEEGQISHFEGIVIDISERKHAEEKIKAA 601
                         330       340       350
                  ....*....|....*....|....*....|....
gi 22299155   737 -EERYRLLAE-------NTSDIICLLDCQGSCLY 762
Cdd:PRK13560  602 lTEKEVLLKEihhrvknNLQIISSLLDLQAEKLH 635
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
504-587 7.50e-12

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312074  Cd Length: 89  Bit Score: 64.67  E-value: 7.50e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    504 VFYLNPMCERLWGVPAEAAAEDGEHLWQLVHPEDREATWQSVLRSAETLTPWFAQWRIIHPtTGEIRWLEGAGQPTRDAD 583
Cdd:pfam08447    1 IIYWSPRFEEILGYTPEELLGKGESWLDLVHPDDRERVREALWEALKGGEPYSGEYRIRRK-DGEYRWVEARARPIRDEN 79

                   ....
gi 22299155    584 GAVV 587
Cdd:pfam08447   80 GKPV 83
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
619-723 2.23e-11

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 63.81  E-value: 2.23e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  619 SNIGFYFCDLHTGTFYVSPSYKAQLGYPAttQEVNLEDWEERLHPEDRDRALAAYRQFLRGEAHYSIDLRLRHCNGTYRW 698
Cdd:cd00130    1 LPDGVIVLDLDGRILYANPAAEQLLGYSP--EELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIW 78
                         90       100
                 ....*....|....*....|....*
gi 22299155  699 FHSEAVLIHDEQGQPSKVVGTNVDI 723
Cdd:cd00130   79 VLVSLTPIRDEGGEVIGLLGVVRDI 103
PAS COG2202
PAS domain [Signal transduction mechanisms];
49-292 9.25e-11

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 63.33  E-value: 9.25e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   49 GVALYDVTGEIVYMNPAGRALLGVEDpattasqicADLRIFYCgSDRPYPKDELPGIQALQGLTVPPMELEVQ---YGDR 125
Cdd:COG2202    1 LILVLDRDGRIIYANEAAEELLGYSA---------EELLGLLL-ALHPEDRDRLRELLRRLLAGEELLSEELRlvrKDGE 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  126 QLTVEVQASPILNPAGQVEFSISTfWEITARKRSELEqqilknyWQAQANRYYEILQSQSDLVLCSRADTTITFANDAFC 205
Cdd:COG2202   71 ERWVELSAAPLRDGEGRVLGLLGL-RDITERKRAEEA-------LRESEERLRALLEASPDGIWVLDEDGRILYANPAAE 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  206 QFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQ--LRPDAPTFVNENRVYHPQYGLRWTQWMNTAIFDAEGNLREIQSVG 283
Cdd:COG2202  143 ELLGYSPEEELGRGLSDLIHPEDEERRELELARalAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIA 222

                 ....*....
gi 22299155  284 RDITALKEQ 292
Cdd:COG2202  223 RDITERKQA 231
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
738-804 9.42e-11

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 60.88  E-value: 9.42e-11
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22299155     738 ERYRLLAENTSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIE 804
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQRLLS 67
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
476-605 3.85e-10

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971  Cd Length: 124  Bit Score: 60.38  E-value: 3.85e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    476 SEECFRLTATNVPGAIFryiqYPDGRNRVFYLNPMCERLWGVPAEAAAedGEHLWQLVHPEDREATWQSVLRSAETLTPW 555
Cdd:TIGR00229    1 SEERYRAIFESSPDAII----VIDLEGNILYVNPAFEEIFGYSAEELI--GRNVLELIPEEDREEVRERIERRLEGEPEP 74
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|
gi 22299155    556 FAQWRIIHPTTGEIRWLEGAGQPTRDADGAVVWHTVILDVTDRHLAEARL 605
Cdd:TIGR00229   75 VSEERRVRRKDGSEIWVEVSVSPIRTNGGELGVVGIVRDITERKEAEEAL 124
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
185-286 4.82e-10

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 59.57  E-value: 4.82e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  185 SDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQLRPDAPTFVNENRVYHPQYGLRWTQW 264
Cdd:cd00130    2 PDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLV 81
                         90       100
                 ....*....|....*....|..
gi 22299155  265 MNTAIFDAEGNLREIQSVGRDI 286
Cdd:cd00130   82 SLTPIRDEGGEVIGLLGVVRDI 103
PAS COG2202
PAS domain [Signal transduction mechanisms];
461-602 1.44e-09

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 59.86  E-value: 1.44e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  461 QELAERRRIEATLRQSEECFRLTATNVPGAIFRYiqypDGRNRVFYLNPMCERLWGVPAEAAAEDGEHLWQLVHPEDREA 540
Cdd:COG2202   95 RDITERKRAEEALRESEERLRALLEASPDGIWVL----DEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEERRE 170
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 22299155  541 TWQSVLRSAETLTPWFAQWRIIHPTTGEIRWLEGAGQPTRDADGAVVWHTVILDVTDRHLAE 602
Cdd:COG2202  171 LELARALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
608-733 3.85e-09

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971  Cd Length: 124  Bit Score: 57.30  E-value: 3.85e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    608 QQAQLELAARVSNIGFYFCDLHtGTF-YVSPSYKAQLGYpaTTQEVNLEDWEERLHPEDRDRALAAYRQFLRGEAH-YSI 685
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLE-GNIlYVNPAFEEIFGY--SAEELIGRNVLELIPEEDREEVRERIERRLEGEPEpVSE 77
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 22299155    686 DLRLRHCNGTYRWFHsEAVLIHDEQGQPSKVVGTNVDITERKATELAL 733
Cdd:TIGR00229   78 ERRVRRKDGSEIWVE-VSVSPIRTNGGELGVVGIVRDITERKEAEEAL 124
Nucleotidyl_cyc_III cd07556
Class III nucleotidyl cyclases; Class III nucleotidyl cyclases are the largest, most diverse ...
898-1007 6.77e-09

Class III nucleotidyl cyclases; Class III nucleotidyl cyclases are the largest, most diverse group of nucleotidyl cyclases (NC's) containing prokaryotic and eukaryotic proteins. They can be divided into two major groups; the mononucleotidyl cyclases (MNC's) and the diguanylate cyclases (DGC's). The MNC's, which include the adenylate cyclases (AC's) and the guanylate cyclases (GC's), have a conserved cyclase homology domain (CHD), while the DGC's have a conserved GGDEF domain, named after a conserved motif within this subgroup. Their products, cyclic guanylyl and adenylyl nucleotides, are second messengers that play important roles in eukaryotic signal transduction and prokaryotic sensory pathways.


Pssm-ID: 143637  Cd Length: 133  Bit Score: 56.60  E-value: 6.77e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  898 VLFFDLDRFKVINDSLGHGVGDQVLIAFATWLRRLVG-NQYTVARFGGDEFVILLThVPHPQRAIALCEEL---IHSLQQ 973
Cdd:cd07556    4 ILFADIVGFTSLADALGPDEGDELLNELAGRFDSLIRrSGDLKIKTIGDEFMVVSG-LDHPAAAVAFAEDMreaVSALNQ 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 22299155  974 PLRVGerqifLSTSIGVvfaqneyETGMAVLRDA 1007
Cdd:cd07556   83 SEGNP-----VRVRIGI-------HTGPVVVGVI 104
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
745-854 1.18e-08

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312075  Cd Length: 110  Bit Score: 55.50  E-value: 1.18e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    745 ENTSDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSRVKQELQQMIEQRQFWPITYQVCTARGDVLW 824
Cdd:pfam08448    2 DSLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGKTLAELLPPEDAARLERALRRALEGEEPIDFLEELLLNGEERHY 81
                           90       100       110
                   ....*....|....*....|....*....|
gi 22299155    825 LETLVkPRYDSQGHVQQLQTTSRDVTSRVQ 854
Cdd:pfam08448   82 ELRLT-PLRDPDGEVIGVLVISRDITERRR 110
PAS_11 pfam14598
PAS domain; This family includes the PAS-B domain of NCOA1 (Nuclear receptor coactivator 1), ...
771-841 1.42e-07

PAS domain; This family includes the PAS-B domain of NCOA1 (Nuclear receptor coactivator 1), which binds to an LXXLL motif in the C-terminal region of STAT6 (Signal transducer and activator of transcription 6).


Pssm-ID: 317051  Cd Length: 112  Bit Score: 52.29  E-value: 1.42e-07
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 22299155    771 LGWPTETLIGEHFTQLCHPEERSRVKQELQQMI-EQRQFWPITYQVCTARGDVLWLETLVKPRYDSQGHVQQ 841
Cdd:pfam14598   27 LGLEKDELVGRSIYDLCHPQDLRTAKSHLREVIdSNGRATSSSYRLRLRDGDFVYVHTKSKLFRNQKTNEQD 98
GAF_2 pfam13185
GAF domain;
309-450 1.93e-07

GAF domain;


Pssm-ID: 315776  Cd Length: 137  Bit Score: 52.08  E-value: 1.93e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    309 SLDLATIFETAVREIAQVGLGVDAAVVQYLPEQGV--WRHIAEYHhdphfpcGEGLEIPDRDNPFAADLKAGNIVIIADS 386
Cdd:pfam13185    1 AADLDELLRAVLEAAVELGASAAGFILLVDDDGRLaaWGGPPDEL-------SAALDDPPGEGLVGEALRTGRPVIVNDL 73
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 22299155    387 REITDPVNQAIAPAFPGAWLLIPLIVADRVWGSLTLFnYPEPHEWSRTEIDLARAVATQLEVAI 450
Cdd:pfam13185   74 AADPRKKGLPAGHAGLRSFLSVPLISGGRVVGVLALG-SPRPGAFDEEDLELLELLAEQAAIAI 136
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
684-726 1.23e-06

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 48.33  E-value: 1.23e-06
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|...
gi 22299155     684 SIDLRLRHCNGTYRWFHSEAVLIHDEQGQPSKVVGTNVDITER 726
Cdd:smart00086    1 TVEYRLRRKDGSYIWVLVSASPIRDEDGEVEGILGVVRDITER 43
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
499-595 2.80e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 48.40  E-value: 2.80e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155  499 DGRNRVFYLNPMCERLWGVPAEAAaeDGEHLWQLVHPEDREATWQSVLRSAETLTPWFAQWRIIHPTTGEIRWLEGAGQP 578
Cdd:cd00130    9 DLDGRILYANPAAEQLLGYSPEEL--IGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVSLTPI 86
                         90
                 ....*....|....*..
gi 22299155  579 TRDADGAVVWHTVILDV 595
Cdd:cd00130   87 RDEGGEVIGLLGVVRDI 103
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
175-286 2.83e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 307226  Cd Length: 113  Bit Score: 48.18  E-value: 2.83e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    175 NRYYEILQSQSDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQLRPDAPTFVNENRVYH 254
Cdd:pfam00989    1 EDLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIPEEDDAEVAELLRQALLQGEESRGFEVSFR 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 22299155    255 -PQYGLRWTQWMNTAIFDAEGNLREIQSVGRDI 286
Cdd:pfam00989   81 vPDGRPRHVEVRASPVRDAGGEILGFLGVLRDI 113
PAS_9 pfam13426
PAS domain;
748-850 3.05e-06

PAS domain;


Pssm-ID: 315989  Cd Length: 102  Bit Score: 48.23  E-value: 3.05e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    748 SDIICLLDCQGSCLYVSPSYETLLGWPTETLIGEHFTQLCHPEERSrvkQELQQMIEQ-RQFWPITYQVCTARGDVLWLE 826
Cdd:pfam13426    1 PDGILITDPDGRIIYVNPAALRLLGYTREELLGKSLTDLFGEPEDA---ERLREALREgRKVRELEVVLVRKDGEPFPVL 77
                           90       100
                   ....*....|....*....|....
gi 22299155    827 TLVKPRYDSQGHVQQLQTTSRDVT 850
Cdd:pfam13426   78 VSASPIKDDGGELVGIIAILRDIT 101
PRK13558 PRK13558
bacterio-opsin activator; Provisional
583-744 1.04e-05

bacterio-opsin activator; Provisional


Pssm-ID: 237426  Cd Length: 665  Bit Score: 49.84  E-value: 1.04e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   583 DGAVVWH-----TVILDVTDRHLAEARLKEQqaqlelAARVSNIGFYFCDLHTGT---FYVSPSYKAQLGYPAttQEVnL 654
Cdd:PRK13558  122 ESAVPEHsrdteARMPISDLTVESDRRLKER------ALDEAPVGITIADATLPDeplIYINDAFERITGYSP--DEV-L 192
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   655 EDWEERLHPEDRD-RALAAYRQFLRGEAHYSIDLRLRHCNGTYRWFHSEAVLIHDEQGQPSKVVGTNVDITERKATELAL 733
Cdd:PRK13558  193 GRNCRFLQGEDTNeERVAELREAIDEERPTSVELRNYRKDGSTFWNQVDIAPIRDEDGTVTHYVGFQTDVTERKEAELAL 272
                         170
                  ....*....|..
gi 22299155   734 -RESEERYRLLA 744
Cdd:PRK13558  273 qRERRKLQRLLE 284
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
619-728 1.16e-05

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312075  Cd Length: 110  Bit Score: 46.25  E-value: 1.16e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    619 SNIGFYFCDLHtGTF-YVSPSYKAQLGYPAttQEVNLEDWEERLHPEDRDRALAAYRQFLRGEAHYSIdLRLRHCNGTYR 697
Cdd:pfam08448    4 LPDALAVLDPD-GRVrYANAAAAELFGLPP--EELLGKTLAELLPPEDAARLERALRRALEGEEPIDF-LEELLLNGEER 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 22299155    698 WFHSEAVLIHDEQGQPSKVVGTNVDITERKA 728
Cdd:pfam08448   80 HYELRLTPLRDPDGEVIGVLVISRDITERRR 110
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
194-299 1.46e-05

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971  Cd Length: 124  Bit Score: 46.13  E-value: 1.46e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    194 DTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQ-LRPDAPTFVNENRVYHPQYGLRWTQWMNTAIFDA 272
Cdd:TIGR00229   22 EGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIERrLEGEPEPVSEERRVRRKDGSEIWVEVSVSPIRTN 101
                           90       100
                   ....*....|....*....|....*..
gi 22299155    273 eGNLREIQSVGRDITALKEQllrEQAL 299
Cdd:TIGR00229  102 -GGELGVVGIVRDITERKEA---EEAL 124
YuxH COG3434
c-di-GMP-related signal transduction protein, contains EAL and HDOD domains [Signal ...
1147-1278 2.98e-05

c-di-GMP-related signal transduction protein, contains EAL and HDOD domains [Signal transduction mechanisms];


Pssm-ID: 225968  Cd Length: 407  Bit Score: 47.79  E-value: 2.98e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155 1147 LDTIRQRYP--LPKGQLLLELTERIgiELGSEMLSLLESLRHRHVEISIDDFGtgYSCLSYLHS-LP-IQHLKVDRSFVS 1222
Cdd:COG3434   70 EELLISDLPelLPPDKVVIEILEDC--PPTEKLLSAIKELKQKGYLLALDDFI--FSNVSEWKPlLPlSDIVKIDFKRVT 145
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 22299155 1223 QLEenernlqiIRMILLLSKQLGYRVIAEGIETPKQLQILQELGCDEGQGYLFARP 1278
Cdd:COG3434  146 FDK--------ARLFDRDLGYINKKFLAEKVETEEEFEQAKKAGFDLFQGYFFSKP 193
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
43-158 3.49e-05

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312075  Cd Length: 110  Bit Score: 45.10  E-value: 3.49e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155     43 LSVLPVGVALYDVTGEIVYMNPAGRALLGVED------------PATTASQICADLRifycgsdrpypkdelpgiQALQG 110
Cdd:pfam08448    1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPeellgktlaellPPEDAARLERALR------------------RALEG 62
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 22299155    111 LTVPPMELEVQYGDRQLTVEVQASPILNPAGQVEFSISTFWEITARKR 158
Cdd:pfam08448   63 EEPIDFLEELLLNGEERHYELRLTPLRDPDGEVIGVLVISRDITERRR 110
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
176-239 4.75e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 43.93  E-value: 4.75e-05
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 22299155     176 RYYEILQSQSDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQL 239
Cdd:smart00091    2 RLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQRL 65
PAS_9 pfam13426
PAS domain;
185-288 5.37e-05

PAS domain;


Pssm-ID: 315989  Cd Length: 102  Bit Score: 44.37  E-value: 5.37e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    185 SDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVaqLRPDAPTFVNENRVYHPQYGLRWTQW 264
Cdd:pfam13426    1 PDGILITDPDGRIIYVNPAALRLLGYTREELLGKSLTDLFGEPEDAERLREA--LREGRKVRELEVVLVRKDGEPFPVLV 78
                           90       100
                   ....*....|....*....|....
gi 22299155    265 MNTAIFDAEGNLREIQSVGRDITA 288
Cdd:pfam13426   79 SASPIKDDGGELVGIIAILRDITE 102
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
499-587 6.09e-05

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 307226  Cd Length: 113  Bit Score: 44.33  E-value: 6.09e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    499 DGRNRVFYLNPMCERLWGVPAEAAAedGEHLWQLVHPEDREATWQSVLRSAETLTPWFAQWRIIHPTTGEIRWLEGAGQP 578
Cdd:pfam00989   18 DEDGRILYVNAAAEELLGLSREEVI--GKSLLDLIPEEDDAEVAELLRQALLQGEESRGFEVSFRVPDGRPRHVEVRASP 95

                   ....*....
gi 22299155    579 TRDADGAVV 587
Cdd:pfam00989   96 VRDAGGEIL 104
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
181-291 2.28e-04

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312075  Cd Length: 110  Bit Score: 42.40  E-value: 2.28e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    181 LQSQSDLVLCSRADTTITFANDAFCQFFSRPASVVIGCPWSEFVLAEDLPPLLEKVAQLRpDAPTFVNENRVYHPQYGLR 260
Cdd:pfam08448    1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGKTLAELLPPEDAARLERALRRAL-EGEEPIDFLEELLLNGEER 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 22299155    261 WTQWMNTAIFDAEGNLREIQSVGRDITALKE 291
Cdd:pfam08448   80 HYELRLTPLRDPDGEVIGVLVISRDITERRR 110
PRK13560 PRK13560
hypothetical protein; Provisional
36-290 2.43e-04

hypothetical protein; Provisional


Pssm-ID: 106506  Cd Length: 807  Bit Score: 45.43  E-value: 2.43e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    36 EHYLAAVLSVLPVGVALYDVTGEIV-YMNPAGRALLGVE------------DPATTASQICADLRIFYcGSDRPYPKDEL 102
Cdd:PRK13560  331 EDMLRAIIEAAPIAAIGLDADGNICfVNNNAAERMLGWSaaevmgkplpgmDPELNEEFWCGDFQEWY-PDGRPMAFDAC 409
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   103 PGIQAL-QGLTVPPMELEVQY-GDRQLTVEVQASPILNPAGQVEFSISTFWEITARKrsELEQQILknywqaQANRYYEi 180
Cdd:PRK13560  410 PMAKTIkGGKIFDGQEVLIEReDDGPADCSAYAEPLHDADGNIIGAIALLVDITERK--QVEEQLL------LANLIVE- 480
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155   181 lqsQSDLVLCS-RADT--TITFANDAFCQFFSRPASVVIGC-PWSEFVLAEDLPPLLEKVAQL-RPDAPTFVNENRVYHP 255
Cdd:PRK13560  481 ---NSPLVLFRwKAEEgwPVELVSKNITQFGYEPDEFISGKrMFAAIIHPADLEQVAAEVAEFaAQGVDRFEQEYRILGK 557
                         250       260       270
                  ....*....|....*....|....*....|....*
gi 22299155   256 QYGLRWTQWMNTAIFDAEGNLREIQSVGRDITALK 290
Cdd:PRK13560  558 GGAVCWIDDQSAAERDEEGQISHFEGIVIDISERK 592
PAS_8 pfam13188
PAS domain;
38-95 3.43e-04

PAS domain;


Pssm-ID: 315779  Cd Length: 65  Bit Score: 41.37  E-value: 3.43e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 22299155     38 YLAAVLSVLPVGVALYDVTGEIVYMNPAGRALLGVEDPATTASQICADLRIFYCGSDR 95
Cdd:pfam13188    2 RLRALFESSPDGILVLDDGGRILYANPAALELLGYELLGELLGELLPDLDPLLEDLLE 59
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
627-723 1.12e-03

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 307226  Cd Length: 113  Bit Score: 40.09  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    627 DLHTGTFYVSPSYKAQLGYPAttQEVNLEDWEERLHPEDRDRALAAYRQFLRGEAHYSI-DLRLRHCNGTYRWFHSEAVL 705
Cdd:pfam00989   18 DEDGRILYVNAAAEELLGLSR--EEVIGKSLLDLIPEEDDAEVAELLRQALLQGEESRGfEVSFRVPDGRPRHVEVRASP 95
                           90
                   ....*....|....*...
gi 22299155    706 IHDEQGQPSKVVGTNVDI 723
Cdd:pfam00989   96 VRDAGGEILGFLGVLRDI 113
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
197-282 1.16e-03

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312074  Cd Length: 89  Bit Score: 40.01  E-value: 1.16e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    197 ITFANDAFCQFFSRPASVVIG--CPWSEFVLAEDLPPLLEKVAQLRPDAPTFVNENRVYHPQYGLRWTQWMNTAIFDAEG 274
Cdd:pfam08447    1 IIYWSPRFEEILGYTPEELLGkgESWLDLVHPDDRERVREALWEALKGGEPYSGEYRIRRKDGEYRWVEARARPIRDENG 80

                   ....*...
gi 22299155    275 NLREIQSV 282
Cdd:pfam08447   81 KPVRVIGV 88
PAS_9 pfam13426
PAS domain;
47-155 4.49e-03

PAS domain;


Pssm-ID: 315989  Cd Length: 102  Bit Score: 38.21  E-value: 4.49e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155     47 PVGVALYDVTGEIVYMNPAGRALLGVeDPATTASQICADLriFYCGSDRPYPKDELPGIQALQGLTVppmeLEVQYGDRQ 126
Cdd:pfam13426    1 PDGILITDPDGRIIYVNPAALRLLGY-TREELLGKSLTDL--FGEPEDAERLREALREGRKVRELEV----VLVRKDGEP 73
                           90       100
                   ....*....|....*....|....*....
gi 22299155    127 LTVEVQASPILNPAGQVEFSISTFWEITA 155
Cdd:pfam13426   74 FPVLVSASPIKDDGGELVGIIAILRDITE 102
PAS_9 pfam13426
PAS domain;
622-725 4.99e-03

PAS domain;


Pssm-ID: 315989  Cd Length: 102  Bit Score: 38.21  E-value: 4.99e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22299155    622 GFYFCDLHTGTFYVSPSYKAQLGYPAttQEVNLEDWEERLHPEDRDRALAAYRQflRGEAHYSIDLRLRHCNGTYRWFHS 701
Cdd:pfam13426    3 GILITDPDGRIIYVNPAALRLLGYTR--EELLGKSLTDLFGEPEDAERLREALR--EGRKVRELEVVLVRKDGEPFPVLV 78
                           90       100
                   ....*....|....*....|....
gi 22299155    702 EAVLIHDEQGQPSKVVGTNVDITE 725
Cdd:pfam13426   79 SASPIKDDGGELVGIIAILRDITE 102
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
610-675 6.67e-03

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 37.38  E-value: 6.67e-03
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22299155     610 AQLELAARVSNIGFYFCDLHTGTFYVSPSYKAQLGYPAttQEVNLEDWEERLHPEDRDRALAAYRQ 675
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSP--EELIGKSLLELIHPEDRERVQEALQR 64
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH