NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|221379236|ref|NP_477007|]
View 

dopamine 1-like receptor 1, isoform B [Drosophila melanogaster]

Protein Classification

7tmA_Ap5-HTB1-like domain-containing protein (domain architecture ID 11606754)

7tmA_Ap5-HTB1-like domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
130-442 0e+00

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


:

Pssm-ID: 320193  Cd Length: 300  Bit Score: 513.82  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 130 VVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDV 209
Cdd:cd15065    1 LIGIFLSLIIVLAIFGNVLVCLAIFTDRRLRKKSNLFIVSLAVADLLVALLVMTFAVVNDLLGYWLFGETFCNIWISFDV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 210 MCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDN--GKKYPTC 287
Cdd:cd15065   81 MCSTASILNLCAISLDRYIHIKKPLKYERWMTTRRALVVIASVWILSALISFLPIHLGWHRLSQDEIKGLNhaSNPKPSC 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 288 ALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVaekqryksirrpknqPKKFKVRNLHTHSS 367
Cdd:cd15065  161 ALDLNPTYAVVSSLISFYIPCLVMLLIYSRLYLYARKHVVNIKSQKLPSES---------------GSKFQVPSLSSKHN 225
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 368 PYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15065  226 NQGVSDHKAAVTLGIIMGVFLICWLPFFIINIIAAFCKTCIPPKCFKILTWLGYFNSCLNPIIYSIFNSEFRRAF 300
 
Name Accession Description Interval E-value
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
130-442 0e+00

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


Pssm-ID: 320193  Cd Length: 300  Bit Score: 513.82  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 130 VVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDV 209
Cdd:cd15065    1 LIGIFLSLIIVLAIFGNVLVCLAIFTDRRLRKKSNLFIVSLAVADLLVALLVMTFAVVNDLLGYWLFGETFCNIWISFDV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 210 MCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDN--GKKYPTC 287
Cdd:cd15065   81 MCSTASILNLCAISLDRYIHIKKPLKYERWMTTRRALVVIASVWILSALISFLPIHLGWHRLSQDEIKGLNhaSNPKPSC 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 288 ALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVaekqryksirrpknqPKKFKVRNLHTHSS 367
Cdd:cd15065  161 ALDLNPTYAVVSSLISFYIPCLVMLLIYSRLYLYARKHVVNIKSQKLPSES---------------GSKFQVPSLSSKHN 225
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 368 PYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15065  226 NQGVSDHKAAVTLGIIMGVFLICWLPFFIINIIAAFCKTCIPPKCFKILTWLGYFNSCLNPIIYSIFNSEFRRAF 300
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
145-431 1.42e-54

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 186.36  E-value: 1.42e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236  145 GNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISM 224
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236  225 DRYIHIKDPLRYGRWVTRrvAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDltPTYAVVSSCISF 304
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRR--AKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFPESLWP--VSYLLFSTVVGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236  305 YFPCVVMIGIYCRLYCYAQKHVKSIKAVTRpgevaekqryksirrpknqpkkfkvrnlhthsspyhvSDHKAAVTVGVIM 384
Cdd:pfam00001 157 LLPLLVILVCYTRIIRTLRKQARSRRRSVR-------------------------------------SERKALKTLLVVV 199
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 221379236  385 GVFLICWVPFFCVNITAAFCKTCIGGQT--------FKILTWLGYSNSAFNPIIY 431
Cdd:pfam00001 200 VVFILCWLPYHILNLLDSLCDLLIIISCvvtpprtlLQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
133-449 1.52e-07

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 53.24  E-value: 1.52e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 133 IFLSVLIF-LSVAGNILVcLAIYTERSLRRIGNLFLASLAIADL-FVASLvmTFAGVNDLLGYWIFGAQFCDTWVAFDVM 210
Cdd:PHA03087  44 IVVYSTIFfFGLVGNIIV-IYVLTKTKIKTPMDIYLLNLAVSDLlFVMTL--PFQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 211 CSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFvpislgihrpdqPLIFEDNGKK------- 283
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETT------------PILFVYTTKKdhetlic 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 284 ---YPTCALDLTPTYAVVSSCISFYFPCVVMigiycrLYCYaqkhvksikavtrpgeVAEKQRYKSIRRPKNQPKKFKVr 360
Cdd:PHA03087 189 cmfYNNKTMNWKLFINFEINIIGMLIPLTIL------LYCY----------------SKILITLKGINKSKKNKKAIKL- 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 361 nlhthsspyhvsdhkaavtVGVIMGVFLICWVPF-FCVNITAAFCKTCIGG-QTFKILTWLGY-------SNSAFNPIIY 431
Cdd:PHA03087 246 -------------------VLIIVILFVIFWLPFnVSVFVYSLHILHFKSGcKAVKYIQYALHvteiislSHCCINPLIY 306
                        330
                 ....*....|....*...
gi 221379236 432 SIFNKEFRDAFKRILTMR 449
Cdd:PHA03087 307 AFVSEFFNKHKKKSLKLM 324
 
Name Accession Description Interval E-value
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
130-442 0e+00

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


Pssm-ID: 320193  Cd Length: 300  Bit Score: 513.82  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 130 VVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDV 209
Cdd:cd15065    1 LIGIFLSLIIVLAIFGNVLVCLAIFTDRRLRKKSNLFIVSLAVADLLVALLVMTFAVVNDLLGYWLFGETFCNIWISFDV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 210 MCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDN--GKKYPTC 287
Cdd:cd15065   81 MCSTASILNLCAISLDRYIHIKKPLKYERWMTTRRALVVIASVWILSALISFLPIHLGWHRLSQDEIKGLNhaSNPKPSC 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 288 ALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVaekqryksirrpknqPKKFKVRNLHTHSS 367
Cdd:cd15065  161 ALDLNPTYAVVSSLISFYIPCLVMLLIYSRLYLYARKHVVNIKSQKLPSES---------------GSKFQVPSLSSKHN 225
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 368 PYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15065  226 NQGVSDHKAAVTLGIIMGVFLICWLPFFIINIIAAFCKTCIPPKCFKILTWLGYFNSCLNPIIYSIFNSEFRRAF 300
7tmA_D1-like_dopamine_R cd15057
D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G ...
129-442 2.23e-99

D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320185  Cd Length: 299  Bit Score: 304.74  E-value: 2.23e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRR-IGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGaQFCDTWVAF 207
Cdd:cd15057    1 IITGCILYLLVLLTLLGNALVIAAVLRFRHLRSkVTNYFIVSLAVSDLLVAILVMPWAAVNEVAGYWPFG-SFCDVWVSF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 208 DVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRpDQPLIFEDNGKKYPT- 286
Cdd:cd15057   80 DIMCSTASILNLCVISVDRYWAISSPFRYERRMTRRRAFIMIAVAWTLSALISFIPVQLGWHR-ADDTSEALALYADPCq 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 287 CALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYK---SIRRPKnqpkkfkvrnlh 363
Cdd:cd15057  159 CDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIARRQIRRIAALERAAQESTNPDSSlrsSLRRET------------ 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 364 thsspyhvsdhKAAVTVGVIMGVFLICWVPFFCVNITAAFC------KTCIGGQTFKILTWLGYSNSAFNPIIYSiFNKE 437
Cdd:cd15057  227 -----------KALKTLSIIMGVFVCCWLPFFILNCVLPFCdlrtaqFPCVPDTTFIVFVWLGWANSSLNPIIYA-FNAD 294

                 ....*
gi 221379236 438 FRDAF 442
Cdd:cd15057  295 FRKAF 299
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
130-442 3.51e-96

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098  Cd Length: 259  Bit Score: 295.24  E-value: 3.51e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 130 VVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDV 209
Cdd:cd14967    1 LLAVFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVADLLVALLVMPFSAVYTLLGYWPFGPVLCRFWIALDV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 210 MCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIfedngkkYPTCAL 289
Cdd:cd14967   81 LCCTASILNLCAISLDRYLAITRPLRYRQLMTKKRALIMIAAVWVYSLLISLPPLVGWRDETQPSVV-------DCECEF 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 290 DLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKhvksikavtrpgevaekqryksirrpknqpkkfkvrnlhthsspy 369
Cdd:cd14967  154 TPNKIYVLVSSVISFFIPLLIMIVLYARIFRVARR--------------------------------------------- 188
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 221379236 370 hvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKT-CIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd14967  189 ---ELKAAKTLAIIVGAFLLCWLPFFIIYLVSAFCPPdCVPPILYAVFFWLGYLNSALNPIIYALFNRDFRRAF 259
7tmA_Histamine_H2R cd15051
histamine subtype H2 receptor, member of the class A family of seven-transmembrane G ...
129-442 2.03e-89

histamine subtype H2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H2R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H2R subtype selectively interacts with the G(s)-type G protein that activates adenylate cyclase, leading to increased cAMP production and activation of Protein Kinase A. H2R is found in various tissues such as the brain, stomach, and heart. Its most prominent role is in histamine-induced gastric acid secretion. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320179  Cd Length: 287  Bit Score: 278.83  E-value: 2.03e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15051    1 IVLGVVLAVIILLTVIGNVLVCLAVAVNRRLRNLTNYFIVSLAVTDLLLGLLVLPFSAIYELRGEWPLGPVFCNIYISLD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKyptCA 288
Cdd:cd15051   81 VMLCTASILNLFAISLDRYLAITAPLRYPSRVTPRRVAIALAAIWVVSLAVSFLPIHLGWNTPDGRVQNGDTPNQ---CR 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTrpgevaekqryksirrpknqpkkfKVRNLHTHSSP 368
Cdd:cd15051  158 FELNPPYVLLVAIGTFYLPLLIMCGVYLRIFRIAREQAKRINALT------------------------PASTANSSKSA 213
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 221379236 369 YHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15051  214 ATAREHKATVTLAAVLGAFIICWFPYFTYFTYRGLCGDNINETALSVVLWLGYANSALNPILYAFLNRDFRRAF 287
7tmA_D1A_dopamine_R cd15320
D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G ...
129-442 3.94e-82

D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320443  Cd Length: 319  Bit Score: 261.09  E-value: 3.94e-82
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLR-RIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAqFCDTWVAF 207
Cdd:cd15320    2 VLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRsKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGS-FCNIWVAF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 208 DVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDN----GKK 283
Cdd:cd15320   81 DIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFIMISVAWTLSVLISFIPVQLNWHKAKPTSFLDLNaslrDLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 284 YPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRpknqpKKFKVRNLH 363
Cdd:cd15320  161 MDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKNCQNSTGNR-----GSGDCQQPE 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 364 THSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKT------CIGGQTFKILTWLGYSNSAFNPIIYSiFNKE 437
Cdd:cd15320  236 SSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCKPtstepfCISSTTFDVFVWFGWANSSLNPIIYA-FNAD 314

                 ....*
gi 221379236 438 FRDAF 442
Cdd:cd15320  315 FRKAF 319
7tmA_Dop1R2-like cd15067
dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the ...
130-442 1.50e-81

dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled dopamine 1-like receptor 2 is expressed in Drosophila heads and it shows significant sequence similarity with vertebrate and invertebrate dopamine receptors. Although the Drosophila Dop1R2 receptor does not cluster into the D1-like structural group, it does show pharmacological properties similar to D1-like receptors. As shown in vertebrate D1-like receptors, agonist stimulation of Dop1R2 activates adenylyl cyclase to increase cAMP levels and also generates a calcium signal through stimulation of phospholipase C.


Pssm-ID: 320195  Cd Length: 262  Bit Score: 257.28  E-value: 1.50e-81
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 130 VVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLG-YWIFGAQFCDTWVAFD 208
Cdd:cd15067    1 LLGVVLSLFCLVTVAGNLLVILAVLRERYLRTVTNYFIVSLAVADLLVGSIVMPFSILHEMTGgYWLFGRDWCDVWHSFD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPI-----SLGIHRPDQPLIFEDNgkk 283
Cdd:cd15067   81 VLASTASILNLCVISLDRYWAITDPISYPSRMTKRRALIMIALVWICSALISFPAIawwraVDPGPSPPNQCLFTDD--- 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 284 yptcaldltPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKhvksikavtrpgevaekqryksirrpknqpkkfkvrnlh 363
Cdd:cd15067  158 ---------SGYLIFSSCVSFYIPLVVMLFTYYRIYRAAAK--------------------------------------- 189
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 364 thsspyhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFC-KTCIGG--QTFKILTWLGYSNSAFNPIIYSIFNKEFRD 440
Cdd:cd15067  190 ---------EQKAAKTLGIVMGVFILCWLPFFVTNILIGFCpSNCVSNpdILFPLVTWLGYINSGMNPIIYACSSRDFRR 260

                 ..
gi 221379236 441 AF 442
Cdd:cd15067  261 AF 262
7tmA_alpha2_AR cd15059
alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G ...
129-442 1.35e-80

alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320187  Cd Length: 261  Bit Score: 254.96  E-value: 1.35e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15059    1 VAISSIVSVVILLIIVGNVLVIVAVLTSRKLRAPQNWFLVSLAVADILVGLLIMPFSLVNELMGYWYFGSVWCEIWLALD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVP-ISLGIHRPDQPLifedngkkYPTC 287
Cdd:cd15059   81 VLFCTASIVNLCAISLDRYWSVTQAVEYNLKRTPRRAKAMIAAVWIISAVISLPPlFGWKDEQPWHGA--------EPQC 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 288 ALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYcyaqkhvksikavtrpgevaekqryksiRRPKNQPKKFkvrnlhthss 367
Cdd:cd15059  153 ELSDDPGYVLFSSIGSFYIPLLIMIIVYARIY----------------------------RAAKRKERRF---------- 194
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 221379236 368 pyhvsdhkaAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQT-FKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15059  195 ---------TLVLGVVMGAFVLCWLPFFFTYPLVVVCKTCGVPELlFKFFFWLGYCNSALNPVIYTIFNKDFRRAF 261
7tmA_D1B_dopamine_R cd15319
D1B (or D5) subtype dopamine receptor, member of the class A family of seven-transmembrane G ...
129-442 3.45e-79

D1B (or D5) subtype dopamine receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320442  Cd Length: 317  Bit Score: 253.34  E-value: 3.45e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLR-RIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAqFCDTWVAF 207
Cdd:cd15319    1 VVTGCLLSLLILWTLLGNILVCAAVVRFRHLRsKVTNIFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGA-FCDVWVAF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 208 DVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYP-- 285
Cdd:cd15319   80 DIMCSTASILNLCVISVDRYWAISSPFRYERKMTQRVALVMISVAWTLSVLISFIPVQLNWHKDSGDDWVGLHNSSISrq 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 286 ---TCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNl 362
Cdd:cd15319  160 veeNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQIQIRRISSLERAAEHAQSCRSNRIDCHHHTSLRTSIKK- 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 363 hthsspyhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKT----------CIGGQTFKILTWLGYSNSAFNPIIYS 432
Cdd:cd15319  239 ----------ETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCDRppadpdaglpCVSETTFDVFVWFGWANSSLNPIIYA 308
                        330
                 ....*....|
gi 221379236 433 iFNKEFRDAF 442
Cdd:cd15319  309 -FNADFRKVF 317
7tmA_Beta_AR cd15058
beta adrenergic receptors (adenoceptors), member of the class A family of seven-transmembrane ...
132-442 4.64e-79

beta adrenergic receptors (adenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta adrenergic receptor (beta adrenoceptor), also known as beta AR, is activated by hormone adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate, as well as pulmonary physiology. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320186  Cd Length: 305  Bit Score: 252.37  E-value: 4.64e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 132 GIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMC 211
Cdd:cd15058    4 LLLLALIILAIVVGNLLVIIAIARTSRLQTMTNIFITSLACADLVMGLLVVPLGATIVVTGKWQLGNFWCELWTSVDVLC 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 212 STASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPlifEDNG-KKYPT-CAL 289
Cdd:cd15058   84 VTASIETLCVIAVDRYIAITRPLRYQVLLTKRRARVIVCVVWIVSALVSFVPIMNQWWRANDP---EANDcYQDPTcCDF 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 290 DLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSI-KAVTR-PGEVAEKQRYKSIRRPKNQPKKfkvrnlhthSS 367
Cdd:cd15058  161 RTNMAYAIASSVVSFYIPLLIMIFVYARVFLIATRQLQLIdKRRLRfQSECPAPQTTSPEGKRSSGRRP---------SR 231
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 368 PYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSiFNKEFRDAF 442
Cdd:cd15058  232 LTVVKEHKALKTLGIIMGTFTLCWLPFFIANIINVFNRNLPPGEVFLLLNWLGYINSGLNPIIYC-RSPEFRTAF 305
7tmA_5-HT1_5_7 cd15064
serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G ...
129-442 5.71e-79

serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes serotonin receptor subtypes 1, 5, and 7 that are activated by the neurotransmitter serotonin. The 5-HT1 and 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family. The 5-HT1 receptor subfamily includes 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as 5-HT2C receptor. The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. The 5-HT7 receptor is coupled to Gs, which positively stimulates adenylate cyclase activity, leading to increased intracellular cAMP formation and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320192  Cd Length: 258  Bit Score: 250.71  E-value: 5.71e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15064    1 VLISVLLSLIILATILGNALVIAAILLTRKLHTPANYLIASLAVADLLVAVLVMPLSAVYELTGRWILGQVLCDIWISLD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIsLGIHRPDQPLIFEdngkkyptCA 288
Cdd:cd15064   81 VTCCTASILHLCVIALDRYWAITDAVEYAHKRTPKRAAVMIALVWTLSICISLPPL-FGWRTPDSEDPSE--------CL 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKhvksikavtrpgevaekqryksirrpknqpkkfkvrnlhthssp 368
Cdd:cd15064  152 ISQDIGYTIFSTFGAFYIPLLLMLILYWKIYRAAAR-------------------------------------------- 187
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 369 yhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTC-IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15064  188 ----ERKAAKTLGIILGAFIVCWLPFFLVALIVPLCSHCwIPLALKSFFLWLGYFNSLINPLIYTFFNKDFRKAF 258
7tmA_5-HT7 cd15329
serotonin receptor subtype 7, member of the class A family of seven-transmembrane G ...
129-442 1.51e-76

serotonin receptor subtype 7, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT7 receptor, one of 14 mammalian serotonin receptors, is a member of the class A of GPCRs and is activated by the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT7 receptor mainly couples to Gs protein, which positively stimulates adenylate cyclase, leading to increased intracellular cAMP formation and calcium influx. 5-HT7 receptor is expressed in various human tissues, mainly in the brain, the lower gastrointestinal tract and in vital blood vessels including the coronary artery. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320452  Cd Length: 260  Bit Score: 244.10  E-value: 1.51e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15329    1 VLIGIVLLIIILGTVVGNALVIIAVCLVKKLRTPSNYLIVSLAVSDLLVALLVMPLAIIYELSGYWPFGEILCDVWISFD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIslgihrpdqpLIFEDNGKKYPTCA 288
Cdd:cd15329   81 VLLCTASILNLCAISVDRYLVITRPLTYAVKRTPKRMALMIAIVWLLSALISIPPL----------FGWKNKVNDPGVCQ 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKhvksikavtrpgevaekqryksirrpknqpkkfkvrnlhthssp 368
Cdd:cd15329  151 VSQDFGYQIYATFGAFYIPLIVMLVLYYKIYRAAKS-------------------------------------------- 186
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 221379236 369 yhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCK----TCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15329  187 ----ERKAIKTLGIIMGAFTLCWLPFFILALLRPFLKpikcSCIPLWLSRLFLWLGYANSFLNPIIYAKFNREFRTPF 260
7tmA_D2-like_dopamine_R cd15053
D2-like dopamine receptors, member of the class A family of seven-transmembrane G ...
132-442 4.76e-76

D2-like dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320181  Cd Length: 263  Bit Score: 243.02  E-value: 4.76e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 132 GIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFA---GVNDllGYWIFGAQFCDTWVAFD 208
Cdd:cd15053    4 ALFLLLLPLLTVFGNVLVIMSVFRERSLQTATNYFIVSLAVADLLVAILVMPFAvyvEVNG--GKWYLGPILCDIYIAMD 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSfVPISLGihrpdqpliFEDNGKKYPTCA 288
Cdd:cd15053   82 VMCSTASIFNLCAISIDRYIAVTQPIKYARQKNSKRVLLTIAIVWVVSAAIA-CPLLFG---------LNNVPYRDPEEC 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLycyaqkhvksikavtrpgevaekqrYKSIRRpknqpkkfkvrnlhthssp 368
Cdd:cd15053  152 RFYNPDFIIYSSISSFYIPCIVMLLLYYRI-------------------------FRALRR------------------- 187
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 369 yhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCK------TCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15053  188 ----EKKATKTLAIVLGVFLFCWLPFFTLNILNAICPklqnqsCHVGPALFSLTTWLGYVNSFLNPIIYTIFNIEFRKAF 263
7tmA_DmOct-betaAR-like cd15066
Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar ...
132-442 2.74e-72

Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar receptors in bilateria; member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Drosophila beta-adrenergic-like octopamine receptors and similar proteins. The biogenic amine octopamine is the invertebrate equivalent of vertebrate adrenergic neurotransmitters and exerts its effects through different G protein-coupled receptor types. Insect octopamine receptors are involved in the modulation of carbohydrate metabolism, muscular tension, cognition and memory. The activation of octopamine receptors mediating these actions leads to an increase in adenylate cyclase activity, thereby increasing cAMP levels. In Drosophila melanogaster, three subgroups have been classified on the basis of their structural homology and functional equivalents with vertebrate beta-adrenergic receptors: DmOctBeta1R, DmOctBeta2R, and DmOctBeta3R.


Pssm-ID: 320194  Cd Length: 265  Bit Score: 233.42  E-value: 2.74e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 132 GIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMC 211
Cdd:cd15066    3 GFAMTLIILAAIFGNLLVIISVMRHRKLRVITNYFVVSLAMADMLVALCAMTFNASVEITGRWMFGYFMCDVWNSLDVYF 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 212 STASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEdngKKYP-TCALD 290
Cdd:cd15066   83 STASILHLCCISVDRYYAIVQPLEYPSKMTKRRVAIMLANVWISPALISFLPIFLGWYTTEEHLQYR---KTHPdQCEFV 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 291 LTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKhvksikavtrpgevaekqryksirrpknqpkkfkvrnlhthsspyh 370
Cdd:cd15066  160 VNKIYALISSSVSFWIPCIVMIFTYYRIYLEAKR---------------------------------------------- 193
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 221379236 371 vsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKT-CIGGQTF-KILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15066  194 --EHKAAKTLGIIMGAFILCWLPFFLWYVTTTLCGDaCPYPPILvSILFWIGYFNSTLNPLIYAYFNRDFREAF 265
7tmA_5-HT6 cd15054
serotonin receptor subtype 6, member of the class A family of seven-transmembrane G ...
129-442 1.75e-71

serotonin receptor subtype 6, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT6 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the mammalian central nervous system (CNS). 5-HT6 receptors are selectively linked to G proteins of the G(s) family, which positively stimulate adenylate cyclase, causing cAMP formation and activation of protein kinase A. The 5-HT6 receptors mediates excitatory neurotransmission and are involved in learning and memory; thus they are promising targets for the treatment of cognitive impairment. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320182  Cd Length: 267  Bit Score: 231.23  E-value: 1.75e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15054    1 GWVAAFLCLIILLTVAGNSLLILLIFTQRSLRNTSNYFLVSLFMSDLMVGLVVMPPAMLNALYGRWVLARDFCPIWYAFD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHR----PDQPLIfeDNGKKY 284
Cdd:cd15054   81 VMCCSASILNLCVISLDRYLLIISPLRYKLRMTPPRALALILAAWTLAALASFLPIELGWHElgheRTLPNL--TSGTVE 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 285 PTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVksikavtrpgevaekqryksirrpknqpkkfkvrnlht 364
Cdd:cd15054  159 GQCRLLVSLPYALVASCLTFFLPSGAICFTYCRILLAARKAL-------------------------------------- 200
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 221379236 365 hsspyhvsdhKAAVTVGVIMGVFLICWVPFFCVNITAAFCKtCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15054  201 ----------KASLTLGILLGMFFVTWLPFFVANVVQAVCD-CVSPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 267
7tmA_Beta3_AR cd15959
beta-3 adrenergic receptors (adenoceptors), member of the class A family of ...
130-442 7.17e-70

beta-3 adrenergic receptors (adenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-3 adrenergic receptor (beta-3 adrenoceptor), also known as beta-3 AR, is activated by adrenaline and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320625  Cd Length: 302  Bit Score: 228.25  E-value: 7.17e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 130 VVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDV 209
Cdd:cd15959    2 LAGALLSLAILVIVGGNLLVIVAIAKTPRLQTMTNVFVTSLACADLVMGLLVVPPGATILLTGHWPLGTTVCELWTSVDV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 210 MCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHR---PDQPLIFEDNGKkypT 286
Cdd:cd15959   82 LCVTASIETLCAIAVDRYLAITNPLRYEALVTKRRARTAVCLVWAISAAISFLPIMNQWWRdgaDEEAQRCYDNPR---C 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 287 CALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKavtrpgevAEKQRYKSIRRPKNQPKKFKVRNlhtHS 366
Cdd:cd15959  159 CDFVTNMPYAIVSSTVSFYVPLLVMIFVYVRVFVVATRQVRLIR--------KDKVRFPPEESPPAESRPACGRR---PS 227
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 221379236 367 SPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSiFNKEFRDAF 442
Cdd:cd15959  228 RLLAIKEHKALKTLGIIMGTFTLCWLPFFVANIIKVFCRSLVPDPAFLFLNWLGYANSAFNPIIYC-RSPDFRSAF 302
7tmA_5-HT2 cd15052
serotonin receptor subtype 2, member of the class A family of seven-transmembrane G ...
133-442 1.95e-68

serotonin receptor subtype 2, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320180  Cd Length: 262  Bit Score: 223.34  E-value: 1.95e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 133 IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLG-YWIFGAQFCDTWVAFDVMC 211
Cdd:cd15052    5 LLLLLLVFAGIGGNILVCLAISLEKRLQNVTNYFLMSLAIADLLVSLLVMPLSILVELFGgVWPLPLVLCLLWVTLDVLM 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 212 STASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSfVPIS-LGIHRPDQplIFEDNgkkypTCALD 290
Cdd:cd15052   85 CTASIMHLCTISLDRYMGIRYPLRTRRNKSRTTVFLKIAIVWLISILIS-SPIPvLGIIDTTN--VLNNG-----QCVLF 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 291 lTPTYAVVSSCISFYFPCVVMIGIYCrlycyaqkhvKSIKAVTRpgevaekqryksirrpknqpkkfkvrnlhthsspyh 370
Cdd:cd15052  157 -NPNFVIYGSIVAFFIPLLIMVITYA----------LTIRLLTN------------------------------------ 189
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 371 vsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTC---IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15052  190 --EQKASKVLGIVFAVFVICWTPFFITNILTGLCEECncrISPWLFSVFVWLGYVSSTINPIIYTIFNKTFRRAF 262
7tmA_tyramine_octopamine_R-like cd15060
tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G ...
129-442 5.03e-67

tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine/octopamine receptors and similar proteins found in insects and other invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320188  Cd Length: 260  Bit Score: 219.61  E-value: 5.03e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15060    1 VVTTILLSVIIAFTIVGNILVILSVFTYRPLRIVQNFFIVSLAVADLAVAIFVLPLNVAYFLLGKWLFGIHLCQMWLTCD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIslgIHRPDQPLIFEDNGKkyptCA 288
Cdd:cd15060   81 ILCCTASILNLCAIALDRYWAIHDPINYAQKRTLKRVLLMIVVVWALSALISVPPL---IGWNDWPENFTETTP----CT 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKhvksikavtrpgevaekqryksirrpknqpkkfkvrnlhthssp 368
Cdd:cd15060  154 LTEEKGYVIYSSSGSFFIPLLIMTIVYVKIFIATSK-------------------------------------------- 189
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 369 yhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFK-ILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15060  190 ----ERRAARTLGIIMGVFVVCWLPFFLMYVILPFCETCSPSAKVVnFITWLGYVNSALNPVIYTIFNLDFRRAF 260
7tmA_TAAR1 cd15314
trace amine-associated receptor 1 and similar receptors, member of the class A family of ...
133-442 7.87e-67

trace amine-associated receptor 1 and similar receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptor 1 (TAAR1) is one of the 15 identified trace amine-associated receptor subtypes, which form a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. TAAR1 is coupled to the Gs protein, which leads to activation of adenylate cyclase, and is thought to play functional role in the regulation of brain monoamines. TAAR1 is also shown to be activated by psychoactive compounds such as Ecstasy (MDMA), amphetamine and LSD. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320438  Cd Length: 282  Bit Score: 219.81  E-value: 7.87e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 133 IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCS 212
Cdd:cd15314    5 IFLGLISLVTVCGNLLVIISIAHFKQLHTPTNYLILSLAVADLLVGGLVMPPSMVRSVETCWYFGDLFCKIHSSFDITLC 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 213 TASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHrpdQPLIFEDNGKKYPTCALDLT 292
Cdd:cd15314   85 TASILNLCFISIDRYYAVCQPLLYRSKITVRVVLVMILISWSVSALVGFGIIFLELN---IKGIYYNHVACEGGCLVFFS 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 293 PTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIK-AVTRPGEVAEKQryksirrpknqpkkfkvrnlhthsspyhv 371
Cdd:cd15314  162 KVSSVVGSVFSFYIPAVIMLCIYLKIFLVAQRQARSIQsARTKSGASSSKM----------------------------- 212
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 221379236 372 sDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15314  213 -ERKATKTLAIVMGVFLLCWTPFFLCNIIDPFINYSIPPVLIEVLNWLGYSNSTLNPFIYAFFYSWFRKAF 282
7tmA_Beta1_AR cd15958
beta-1 adrenergic receptors (adrenoceptors), member of the class A family of ...
131-442 3.70e-66

beta-1 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-1 adrenergic receptor (beta-1 adrenoceptor), also known as beta-1 AR, is activated by adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320624  Cd Length: 298  Bit Score: 218.62  E-value: 3.70e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 131 VGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVM 210
Cdd:cd15958    3 MSLLMALIVLLIVAGNVLVIVAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGRWLYGSFFCELWTSVDVL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 211 CSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPL---IFEDNGkkypTC 287
Cdd:cd15958   83 CVTASIETLCVIAIDRYLAITSPFRYQSLLTRARAKGIVCTVWAISALVSFLPIMMHWWRDEDDQalkCYEDPG----CC 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 288 ALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIkavtrpgEVAEKQRYKSIRRPKNQPKKFKVRNLhthss 367
Cdd:cd15958  159 DFVTNRAYAIASSIISFYIPLLIMIFVYLRVYREAKKQIKKI-------DKCEGRFHNTLTGLGRKCKRRPSRIL----- 226
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 368 pyHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSiFNKEFRDAF 442
Cdd:cd15958  227 --ALREQKALKTLGIIMGVFTLCWLPFFLVNVVNVFNRELVPDWLFVFFNWLGYANSAFNPIIYC-RSPDFRKAF 298
7tmA_5-HT4 cd15056
serotonin receptor subtype 4, member of the class A family of seven-transmembrane G ...
129-442 2.04e-65

serotonin receptor subtype 4, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT4 subtype is a member of the serotonin receptor family that belongs to the class A G protein-coupled receptors, and binds the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the mammalian central nervous system (CNS). 5-HT4 receptors are selectively linked to G proteins of the G(s) family, which positively stimulate adenylate cyclase, causing cAMP formation and activation of protein kinase A. 5-HT4 receptor-specific agonists have been shown to enhance learning and memory in animal studies. Moreover, hippocampal 5-HT4 receptor expression has been reported to be inversely correlated with memory performance in humans. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320184  Cd Length: 294  Bit Score: 216.20  E-value: 2.04e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15056    1 VVLSTFLSLVILLTILGNLLVIVAVCTDRQLRKKTNYFVVSLAVADLLVAVLVMPFGAIELVNNRWIYGETFCLVRTSLD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVItIAAIWLLAAFVSFVPISLG-IHRPDQPLIFEDNGKKYPTC 287
Cdd:cd15056   81 VLLTTASIMHLCCIALDRYYAICCQPLVYKMTPLRVAVM-LGGCWVIPTFISFLPIMQGwNHIGIEDLIAFNCASGSTSC 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 288 ALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPkkfkvrnlhthss 367
Cdd:cd15056  160 VFMVNKPFAIICSTVAFYIPALLMVLAYYRIYVAAREQAHQIRSLQRAGSSNHEADQHRNSRMRTET------------- 226
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 368 pyhvsdhKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15056  227 -------KAAKTLGIIMGCFCVCWAPFFVTNIVDPFIGYRVPYLLWTAFLWLGYINSGLNPFLYAFFNKSFRRAF 294
7tmA_tyramine_R-like cd15061
tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
130-442 1.90e-64

tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine-specific receptors and similar proteins found in insects and other invertebrates. These tyramine receptors form a distinct receptor family that is phylogenetically different from the other tyramine/octopamine receptors which also found in invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320189  Cd Length: 256  Bit Score: 212.61  E-value: 1.90e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 130 VVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDV 209
Cdd:cd15061    1 ILISFLILAIIFTIFGNLLVILAVATTRRLRTITNCYIVSLATADLLVGVLVLPLAIIRQLLGYWPLGSHLCDFWISLDV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 210 MCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRpdqplIFEDNGKkyptCAL 289
Cdd:cd15061   81 LLCTASILNLCCISLDRYFAITYPLKYRTKRSRRLAITMILAVWVISLLITSPPLVGPSWH-----GRRGLGS----CYY 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 290 DLTPTYAVVSSCISFYFPCVVMIGIYCRLYCyaqkhvksikavtrpgeVAEKQRyksirrpknqpkkfkvrnlhthsspy 369
Cdd:cd15061  152 TYDKGYRIYSSMGSFFLPLLLMLFVYLRIFR-----------------VIAKER-------------------------- 188
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 221379236 370 hvsdhKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15061  189 -----KTAKTLAIVVGCFIVCWLPFFIMYLIEPFCDCQFSEALSTAFTWLGYFNSVINPFIYAFYNKDFRRAF 256
7tmA_TAARs cd15055
trace amine-associated receptors, member of the class A family of seven-transmembrane G ...
129-442 2.61e-64

trace amine-associated receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptors (TAARs) are a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320183  Cd Length: 285  Bit Score: 213.18  E-value: 2.61e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15055    1 VLLYIVLSSISLLTVLGNLLVIISISHFKQLHTPTNLLLLSLAVADFLVGLLVMPFSMIRSIETCWYFGDTFCKLHSSLD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKkyptCA 288
Cdd:cd15055   81 YILTSASIFNLVLIAIDRYVAVCDPLLYPTKITIRRVKICICLCWFVSALYSSVLLYDNLNQPGLIRYNSCYGE----CV 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQryksirrpKNQPKKfkvrnlhthssp 368
Cdd:cd15055  157 VVVNFIWGVVDLVLTFILPCTVMIVLYMRIFVVARSQARAIRSHTAQVSLEGSS--------KKVSKK------------ 216
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 221379236 369 yhvSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTciGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15055  217 ---SERKAAKTLGIVVGVFLLCWLPYYIVSLVDPYIST--PSSVFDVLIWLGYFNSCLNPLIYALFYPWFRKAL 285
7tmA_alpha1B_AR cd15326
alpha-1 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
129-442 3.19e-63

alpha-1 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320449  Cd Length: 261  Bit Score: 209.36  E-value: 3.19e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15326    1 ILLGLVLGAFILFAIVGNILVILSVVCNRHLRIPTNYFIVNLAIADLLLSFTVLPFSATLEILGYWVFGRIFCDIWAAVD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIsLGIHRPDQPLIFEdngkkyptCA 288
Cdd:cd15326   81 VLCCTASILSLCAISIDRYIGVRHSLQYPTIVTRKRAILALLGVWVLSTVISIGPL-LGWKEPAPPDDKV--------CE 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKsikavtrpgevaekqryksirrpknqpkkfkvrnlhthssp 368
Cdd:cd15326  152 ITEEPFYALFSSLGSFYIPLIVILVMYCRVYIVALKFSR----------------------------------------- 190
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 369 yhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQT-FKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15326  191 ----EKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSHLKPPETlFKIIFWLGYFNSCLNPIIYPCSSKEFKRAF 261
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
133-435 8.33e-62

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 205.97  E-value: 8.33e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 133 IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCS 212
Cdd:cd00637    3 VLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLLVIPFSLVSLLLGGWWFGDALCKLLGFLQTVSL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 213 TASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFedngKKYPTCALDLT 292
Cdd:cd00637   83 TASILTLTAISVDRYLAIVHPLRYRRRFTKRRAKLVIALIWLLSLLLALPPLLGWKVYEYGGYCC----CCLCWPDLTLS 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 293 PTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKavtrpgevaekqryksirrpknqpkkfkvRNLHTHSSPYHVS 372
Cdd:cd00637  159 KAYTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRKRIS-----------------------------SSSNSSRRRRRRR 209
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 373 DHKAAVTVGVIMGVFLICWVPFFCVNITAAFC--KTCIGGQTFKILTWLGYSNSAFNPIIYSIFN 435
Cdd:cd00637  210 ERKVTKMLLIVVVVFLLCWLPYFILFLLDVFGpdPSPLPRILYFLALLLAYLNSAINPIIYAFFN 274
7tmA_Beta2_AR cd15957
beta-2 adrenergic receptors (adrenoceptors), member of the class A family of ...
129-442 5.47e-61

beta-2 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; Beta-2 AR is activated by adrenaline that plays important roles in cardiac function and pulmonary physiology. While beta-1 AR and beta-2 AR are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway, beta-2 AR can couple to both G(s) and G(i) proteins in the heart. Moreover, beta-2 AR activation leads to smooth muscle relaxation and bronchodilation in the lung. The beta adrenergic receptors are a subfamily of the class A rhodopsin-like G protein-coupled receptors.


Pssm-ID: 320623  Cd Length: 303  Bit Score: 205.10  E-value: 5.47e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15957    1 VGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILLKTWTFGNFWCEFWTSID 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFedNGKKYPTCA 288
Cdd:cd15957   81 VLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAI--NCYAEETCC 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLT-PTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRpgevaekqRYKSIRRPKNQPKKfKVRNLHTHSS 367
Cdd:cd15957  159 DFFTnQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEG--------RFHNQNLSQVEQDG-RGGHGLRRRS 229
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 368 PYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSiFNKEFRDAF 442
Cdd:cd15957  230 KFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF 303
7tmA_Octopamine_R cd15063
octopamine receptors in invertebrates, member of the class A family of seven-transmembrane G ...
125-442 1.04e-60

octopamine receptors in invertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor for octopamine (OA), which functions as a neurotransmitter, neurohormone, and neuromodulator in invertebrate nervous system. Octopamine (also known as beta, 4-dihydroxyphenethylamine) is an endogenous trace amine that is highly similar to norepinephrine, but lacks a hydroxyl group, and has effects on the adrenergic and dopaminergic nervous systems. Based on the pharmacological and signaling profiles, the octopamine receptors can be classified into at least two groups: OA1 receptors elevate intracellular calcium levels in muscle, whereas OA2 receptors activate adenylate cyclase and increase cAMP production.


Pssm-ID: 320191  Cd Length: 266  Bit Score: 203.11  E-value: 1.04e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 125 LVSIVVvgifLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTW 204
Cdd:cd15063    1 LISLLV----LTFLNVLVVLGNLLVIAAVLCSRKLRTVTNLFIVSLACADLLVGTLVLPFSAVNEVLDVWIFGHTWCQIW 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 205 VAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKY 284
Cdd:cd15063   77 LAVDVWMCTASILNLCAISLDRYLAITRPIRYPSLMSTKRAKCLIAGVWVLSFVICFPPLVGWNDGKDGIMDYSGSSSLP 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 285 PTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVksikavtrpgevaekqryksirrpknqpkkfkvrnlht 364
Cdd:cd15063  157 CTCELTNGRGYVIYSALGSFYIPMLVMLFFYFRIYRAARMET-------------------------------------- 198
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 221379236 365 hsspyhvsdhKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15063  199 ----------KAAKTVAIIVGCFIFCWLPFFTVYLVRAFCEDCIPPLLFSVFFWLGYCNSALNPCIYALFSRDFRFAF 266
7tmA_alpha2B_AR cd15321
alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
124-442 1.84e-60

alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320444  Cd Length: 268  Bit Score: 202.46  E-value: 1.84e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 124 SLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDT 203
Cdd:cd15321    2 SVQATAAIAAAITFLILFTIFGNVLVIIAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFRKTWCEI 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 204 WVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVP-ISLGIHRPDQplifedNGK 282
Cdd:cd15321   82 YLALDVLFCTSSIVHLCAISLDRYWSVSRAIEYNSKRTPRRIKCIILIVWLIAAVISLPPlIYKGKQKDEQ------GGL 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 283 kyPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAqkhvksikavtrpgevaekqryksirrpKNQPKKFkvrnl 362
Cdd:cd15321  156 --PQCKLNEEAWYILSSSIGSFFAPCLIMILVYLRIYLIA----------------------------KNREKRF----- 200
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 363 hthsspyhvsdhkaAVTVGVIMGVFLICWVPFFCVNITAAFC-KTC-IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRD 440
Cdd:cd15321  201 --------------TFVLAVVIGVFVLCWFPFFFSYSLGAICpELCkVPHSLFQFFFWIGYCNSSLNPVIYTIFNQDFRR 266

                 ..
gi 221379236 441 AF 442
Cdd:cd15321  267 AF 268
7tmA_5-HT1A_invertebrates cd15331
serotonin receptor subtype 1A from invertebrates, member of the class A family of ...
129-442 2.71e-60

serotonin receptor subtype 1A from invertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320454  Cd Length: 261  Bit Score: 201.81  E-value: 2.71e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15331    1 VLTSIILGLLILATIIGNVFVIAAILLERSLQGVSNYLILSLAVADLMVAVLVMPLSAVYEVSQHWFLGPEVCDMWISMD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDpLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIsLGIHRPDqpliFEDNGKKYPTCA 288
Cdd:cd15331   81 VLCCTASILHLVAIALDRYWAVTN-IDYIRRRTAKRILIMIAVVWFVSLIISIAPL-FGWKDED----DLDRVLKTGVCL 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYcyaqkhvksikavtrpgEVAEKQRyksirrpknqpkkfkvrnlhthssp 368
Cdd:cd15331  155 ISQDYGYTIFSTVGAFYVPLLLMIIIYWKIY-----------------QAAKRER------------------------- 192
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 369 yhvsdhKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTC-IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15331  193 ------KAARTLAIITGAFVVCWLPFFLVALVMPFCGAWqISRFLESFFLWLGYFNSLLNPIIYTIFSPDFRGAF 261
7tmA_alpha1_AR cd15062
alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G ...
129-442 8.40e-60

alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320190  Cd Length: 261  Bit Score: 200.41  E-value: 8.40e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15062    1 IVVGVALGAFILFAIGGNLLVILSVACNRHLRTPTHYFIVNLAVADLLLSFTVLPFSATLEVLGYWAFGRIFCDVWAAVD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIsLGIHRPDQPlifedngkKYPTCA 288
Cdd:cd15062   81 VLCCTASIMSLCVISVDRYIGVRYPLNYPTIVTARRATVALLIVWVLSLVISIGPL-LGWKEPAPA--------DEQACG 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKhvksikavtrpgevaekqryksIRRPKnqpkkfkvrnlhthssp 368
Cdd:cd15062  152 VNEEPGYVLFSSLGSFYLPLAIILVMYCRVYVVAFK----------------------FSREK----------------- 192
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 369 yhvsdhKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTC-IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15062  193 ------KAAKTLGIVVGAFVLCWFPFFVVLPLGSLFSTLkPPEPVFKVVFWLGYFNSCLNPIIYPCSSREFKRAF 261
7tmA_alpha2C_AR cd15323
alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G ...
135-442 2.13e-59

alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320446  Cd Length: 261  Bit Score: 199.39  E-value: 2.13e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 135 LSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTA 214
Cdd:cd15323    7 VGFLIVFTIVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMGYWYFGQVWCNIYLALDVLFCTS 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 215 SILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDqplifednGKKYPTCALDlTPT 294
Cdd:cd15323   87 SIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKAIIVTVWLISAVISFPPLISMYRDPE--------GDVYPQCKLN-DET 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 295 YAVVSSCI-SFYFPCVVMIGIYCRLYcyaqkhvksikavtrpgevaekqryksiRRPKNQPKKFkvrnlhthsspyhvsd 373
Cdd:cd15323  158 WYILSSCIgSFFAPCLIMILVYIRIY----------------------------RVAKAREKRF---------------- 193
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 221379236 374 hkaAVTVGVIMGVFLICWVPFFCVNITAAFCKTC--IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15323  194 ---TFVLAVVMGVFVVCWFPFFFSYSLYGICREAceVPEPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRSF 261
7tmA_alpha1D_AR cd15327
alpha-1 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G ...
129-442 1.64e-58

alpha-1 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320450  Cd Length: 261  Bit Score: 197.06  E-value: 1.64e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15327    1 VGVGVFLAIFILMAIVGNILVILSVACNRHLQTVTNYFIVNLAIADLLLSTTVLPFSATLEVLGFWAFGRVFCDIWAAVD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIsLGIHRPDQPlifeDNGKkyptCA 288
Cdd:cd15327   81 VLCCTASILSLCVISVDRYVGVKHSLKYPTIMTERKAGVILVLLWVSSMVISIGPL-LGWKEPPPP----DESI----CS 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKsikavtrpgevaekqryksirrpknqpkkfkvrnlhthssp 368
Cdd:cd15327  152 ITEEPGYALFSSLFSFYLPLMVILVMYFRVYVVALKFSR----------------------------------------- 190
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 369 yhvsDHKAAVTVGVIMGVFLICWVPFFCV-NITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15327  191 ----EKKAAKTLAIVVGVFILCWFPFFFVlPLGSFFPALKPSEMVFKVIFWLGYFNSCVNPIIYPCSSKEFKRAF 261
7tmA_alpha1A_AR cd15325
alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
129-442 8.77e-58

alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320448  Cd Length: 261  Bit Score: 195.11  E-value: 8.77e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15325    1 IVLGVILGGFILFGVLGNILVILSVACHRHLQTVTHYFIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIsLGIHRPDQplifEDNgkkyPTCA 288
Cdd:cd15325   81 VLCCTASIMSLCIISIDRYIGVSYPLRYPSIMTERRGLLALLCVWVLSLVISIGPL-FGWKEPAP----EDE----TICQ 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 289 LDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKsikavtrpgevaekqryksirrpknqpkkfkvrnlhthssp 368
Cdd:cd15325  152 ITEEPGYALFSALGSFYLPLAIILVMYCRVYVVALKFSR----------------------------------------- 190
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 221379236 369 yhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQT-FKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15325  191 ----EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIFPAYKPSDTvFKITFWLGYFNSCINPIIYPCSSQEFKKAF 261
7tmA_TAAR2_3_4 cd15312
trace amine-associated receptors 2, 3, 4, and similar receptors, member of the class A family ...
129-442 1.95e-56

trace amine-associated receptors 2, 3, 4, and similar receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; TAAR2, TAAR3, and TAAR4 are among the 15 identified trace amine-associated receptor subtypes, which form a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320437  Cd Length: 289  Bit Score: 192.57  E-value: 1.95e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFD 208
Cdd:cd15312    1 VAMYLFMAGAILLTVFGNLMVIISISHFKQLHSPTNFLILSLAITDFLLGFLVMPYSMVRSVESCWYFGDLFCKIHSSLD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 209 VMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHR---PDQPLIFEDNGkkyp 285
Cdd:cd15312   81 MMLSTTSIFHLCFIAVDRYYAVCDPLHYRTKITTPVIKVFLVISWSVPCLFAFGVVFSEVNLegiEDYVALVSCTG---- 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 286 TCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQryksirrpKNQPKKfkvrnlhth 365
Cdd:cd15312  157 SCVLIFNKLWGVIASLIAFFIPGTVMIGIYIKIFFVARKHAKVINNRPSVTKGDSKN--------KLSKKK--------- 219
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 221379236 366 sspyhvsDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAF 442
Cdd:cd15312  220 -------ERKAAKTLSIVMGVFLLCWLPFFVATLIDPFLNFSTPVDLFDALVWLGYFNSTCNPLIYGFFYPWFQKAF 289
7tmA_alpha2A_AR cd15322
alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
133-442 6.24e-56

alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320445  Cd Length: 259  Bit Score: 190.16  E-value: 6.24e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221379236 133 IFLSVL