NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|214010170|ref|NP_038520|]
View 

clusterin preproprotein [Mus musculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CLa smart00035
CLUSTERIN alpha chain;
227-442 9.40e-143

CLUSTERIN alpha chain;


:

Pssm-ID: 128350  Cd Length: 216  Bit Score: 409.94  E-value: 9.40e-143
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   227 SLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQE 306
Cdd:smart00035   1 NLMPFPQYWPLNFHDMFQPFFDMIHQAQQAMDTHLHRPPYQFPKQDFAEEHGDDRTVCKEIRHNSTGCLKMKDQCEKCQE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   307 ILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVS 386
Cdd:smart00035  81 ILSVDCSTNNPDQPQLRQELDESLQLAERFTQQYDQLLQSYQKKMLNTSSLLEQLNEQFGWVSQLANLTQGEDQYYLQVT 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 214010170   387 TVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYR 442
Cdd:smart00035 161 TVPSHTSDSSVPSGTTKVVVKLFDSDPITLTIPEEVSADNPKFMETVAEKALQHYR 216
CLb smart00030
CLUSTERIN Beta chain;
22-226 1.96e-127

CLUSTERIN Beta chain;


:

Pssm-ID: 128345  Cd Length: 206  Bit Score: 370.69  E-value: 1.96e-127
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170    22 EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVC 101
Cdd:smart00030   1 DKTVSDNELQEMSTQGSKYINKEIKNALKGVKQIKTLIEKTNKERKSLLSTLEEAKKKKEEALKDTRESEEKLKESQGVC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   102 NETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFAR 181
Cdd:smart00030  81 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQSHVLDVMEDSFSR 160
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*.
gi 214010170   182 ASGIIDTLFQDRFFARELHDPHYFSPIGFPHKR-PHFLYPKSRLVR 226
Cdd:smart00030 161 ASSIVDELFQDRFFTREPQDTTFYSPFSSPHRRtEPFFFPKSRLAR 206
Clusterin pfam01093
Clusterin;
29-444 0e+00

Clusterin;


:

Pssm-ID: 279439 [Multi-domain]  Cd Length: 415  Bit Score: 591.45  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   29 ELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMAL 108
Cdd:pfam01093   1 ELKELSEQGEKYVDEEVKNALNGVKQMKTLMERTEEEHKKLMKTLEKSKEKKEEALKLAKEVEEKLEEEEEVCNESMMAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  109 WEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDT 188
Cdd:pfam01093  81 WEECKPCLESTCMKFYTRTCRSGSGLVGRQLEEFLNRSSPFSFWINGDRIDDLLEEDQEQDAQLVQMEDSFSQLSSDVDS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  189 LFQDRFFARELHDPHYFSPIGFPHKRPHFLY-----------PKSRLVRSLmspshygppSFHNMFQPFFEMIHQAQQAM 257
Cdd:pfam01093 161 LFNRSFFVFKQMQPEFDQAFQSYFMSDLDLTepyflppkepaRKSRFLRSW---------GFPNVFQPFFDFSRSIFESF 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  258 DVQLHSPAFQFPDVDFLREG-EDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCstnnPAQANLRQELNDSLQVAERL 336
Cdd:pfam01093 232 SAVITETLDSIHGGVFSKMLpGQDRMLCRELRRNSSGCLKFKDRCEKCQEILSVDC----PSVPELHEELDEALRLAEVS 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  337 TEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYlRVSTVTTHSSDSE-VPSRVTEVVVKLFDSDPIT 415
Cdd:pfam01093 308 TQQYDELLQIVQHHMEDTSSLLDQMNEQFGWVSQLANQTQGPENIF-NVTTVVPRSSEGNsSKPADTKVEVSILDSPPFT 386
                         410       420
                  ....*....|....*....|....*....
gi 214010170  416 VVLPEEVSKDNPKFMDTVAEKALQEYRRK 444
Cdd:pfam01093 387 LTVPGELSWDDPKFIEYVAEKALQHYKQN 415
 
Name Accession Description Interval E-value
CLa smart00035
CLUSTERIN alpha chain;
227-442 9.40e-143

CLUSTERIN alpha chain;


Pssm-ID: 128350  Cd Length: 216  Bit Score: 409.94  E-value: 9.40e-143
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   227 SLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQE 306
Cdd:smart00035   1 NLMPFPQYWPLNFHDMFQPFFDMIHQAQQAMDTHLHRPPYQFPKQDFAEEHGDDRTVCKEIRHNSTGCLKMKDQCEKCQE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   307 ILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVS 386
Cdd:smart00035  81 ILSVDCSTNNPDQPQLRQELDESLQLAERFTQQYDQLLQSYQKKMLNTSSLLEQLNEQFGWVSQLANLTQGEDQYYLQVT 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 214010170   387 TVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYR 442
Cdd:smart00035 161 TVPSHTSDSSVPSGTTKVVVKLFDSDPITLTIPEEVSADNPKFMETVAEKALQHYR 216
CLb smart00030
CLUSTERIN Beta chain;
22-226 1.96e-127

CLUSTERIN Beta chain;


Pssm-ID: 128345  Cd Length: 206  Bit Score: 370.69  E-value: 1.96e-127
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170    22 EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVC 101
Cdd:smart00030   1 DKTVSDNELQEMSTQGSKYINKEIKNALKGVKQIKTLIEKTNKERKSLLSTLEEAKKKKEEALKDTRESEEKLKESQGVC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   102 NETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFAR 181
Cdd:smart00030  81 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQSHVLDVMEDSFSR 160
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*.
gi 214010170   182 ASGIIDTLFQDRFFARELHDPHYFSPIGFPHKR-PHFLYPKSRLVR 226
Cdd:smart00030 161 ASSIVDELFQDRFFTREPQDTTFYSPFSSPHRRtEPFFFPKSRLAR 206
Clusterin pfam01093
Clusterin;
29-444 0e+00

Clusterin;


Pssm-ID: 279439 [Multi-domain]  Cd Length: 415  Bit Score: 591.45  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   29 ELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMAL 108
Cdd:pfam01093   1 ELKELSEQGEKYVDEEVKNALNGVKQMKTLMERTEEEHKKLMKTLEKSKEKKEEALKLAKEVEEKLEEEEEVCNESMMAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  109 WEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDT 188
Cdd:pfam01093  81 WEECKPCLESTCMKFYTRTCRSGSGLVGRQLEEFLNRSSPFSFWINGDRIDDLLEEDQEQDAQLVQMEDSFSQLSSDVDS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  189 LFQDRFFARELHDPHYFSPIGFPHKRPHFLY-----------PKSRLVRSLmspshygppSFHNMFQPFFEMIHQAQQAM 257
Cdd:pfam01093 161 LFNRSFFVFKQMQPEFDQAFQSYFMSDLDLTepyflppkepaRKSRFLRSW---------GFPNVFQPFFDFSRSIFESF 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  258 DVQLHSPAFQFPDVDFLREG-EDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCstnnPAQANLRQELNDSLQVAERL 336
Cdd:pfam01093 232 SAVITETLDSIHGGVFSKMLpGQDRMLCRELRRNSSGCLKFKDRCEKCQEILSVDC----PSVPELHEELDEALRLAEVS 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  337 TEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYlRVSTVTTHSSDSE-VPSRVTEVVVKLFDSDPIT 415
Cdd:pfam01093 308 TQQYDELLQIVQHHMEDTSSLLDQMNEQFGWVSQLANQTQGPENIF-NVTTVVPRSSEGNsSKPADTKVEVSILDSPPFT 386
                         410       420
                  ....*....|....*....|....*....
gi 214010170  416 VVLPEEVSKDNPKFMDTVAEKALQEYRRK 444
Cdd:pfam01093 387 LTVPGELSWDDPKFIEYVAEKALQHYKQN 415
 
Name Accession Description Interval E-value
CLa smart00035
CLUSTERIN alpha chain;
227-442 9.40e-143

CLUSTERIN alpha chain;


Pssm-ID: 128350  Cd Length: 216  Bit Score: 409.94  E-value: 9.40e-143
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   227 SLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQE 306
Cdd:smart00035   1 NLMPFPQYWPLNFHDMFQPFFDMIHQAQQAMDTHLHRPPYQFPKQDFAEEHGDDRTVCKEIRHNSTGCLKMKDQCEKCQE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   307 ILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVS 386
Cdd:smart00035  81 ILSVDCSTNNPDQPQLRQELDESLQLAERFTQQYDQLLQSYQKKMLNTSSLLEQLNEQFGWVSQLANLTQGEDQYYLQVT 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 214010170   387 TVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYR 442
Cdd:smart00035 161 TVPSHTSDSSVPSGTTKVVVKLFDSDPITLTIPEEVSADNPKFMETVAEKALQHYR 216
CLb smart00030
CLUSTERIN Beta chain;
22-226 1.96e-127

CLUSTERIN Beta chain;


Pssm-ID: 128345  Cd Length: 206  Bit Score: 370.69  E-value: 1.96e-127
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170    22 EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVC 101
Cdd:smart00030   1 DKTVSDNELQEMSTQGSKYINKEIKNALKGVKQIKTLIEKTNKERKSLLSTLEEAKKKKEEALKDTRESEEKLKESQGVC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   102 NETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFAR 181
Cdd:smart00030  81 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQSHVLDVMEDSFSR 160
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*.
gi 214010170   182 ASGIIDTLFQDRFFARELHDPHYFSPIGFPHKR-PHFLYPKSRLVR 226
Cdd:smart00030 161 ASSIVDELFQDRFFTREPQDTTFYSPFSSPHRRtEPFFFPKSRLAR 206
Clusterin pfam01093
Clusterin;
29-444 0e+00

Clusterin;


Pssm-ID: 279439 [Multi-domain]  Cd Length: 415  Bit Score: 591.45  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170   29 ELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMAL 108
Cdd:pfam01093   1 ELKELSEQGEKYVDEEVKNALNGVKQMKTLMERTEEEHKKLMKTLEKSKEKKEEALKLAKEVEEKLEEEEEVCNESMMAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  109 WEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDT 188
Cdd:pfam01093  81 WEECKPCLESTCMKFYTRTCRSGSGLVGRQLEEFLNRSSPFSFWINGDRIDDLLEEDQEQDAQLVQMEDSFSQLSSDVDS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  189 LFQDRFFARELHDPHYFSPIGFPHKRPHFLY-----------PKSRLVRSLmspshygppSFHNMFQPFFEMIHQAQQAM 257
Cdd:pfam01093 161 LFNRSFFVFKQMQPEFDQAFQSYFMSDLDLTepyflppkepaRKSRFLRSW---------GFPNVFQPFFDFSRSIFESF 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  258 DVQLHSPAFQFPDVDFLREG-EDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCstnnPAQANLRQELNDSLQVAERL 336
Cdd:pfam01093 232 SAVITETLDSIHGGVFSKMLpGQDRMLCRELRRNSSGCLKFKDRCEKCQEILSVDC----PSVPELHEELDEALRLAEVS 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 214010170  337 TEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYlRVSTVTTHSSDSE-VPSRVTEVVVKLFDSDPIT 415
Cdd:pfam01093 308 TQQYDELLQIVQHHMEDTSSLLDQMNEQFGWVSQLANQTQGPENIF-NVTTVVPRSSEGNsSKPADTKVEVSILDSPPFT 386
                         410       420
                  ....*....|....*....|....*....
gi 214010170  416 VVLPEEVSKDNPKFMDTVAEKALQEYRRK 444
Cdd:pfam01093 387 LTVPGELSWDDPKFIEYVAEKALQHYKQN 415
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH