NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|213512072|ref|NP_001093975|]
View 

ATPase ASNA1 [Rattus norvegicus]

Protein Classification

similar to arsenical pump-driving ATPase (domain architecture ID 11130961)

protein similar to arsenical pump-driving ATPase

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ArsA_ATPase pfam02374
Anion-transporting ATPase; This Pfam family represents a conserved domain, which is sometimes ...
37-340 4.14e-144

Anion-transporting ATPase; This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.


:

Pssm-ID: 280525  Cd Length: 304  Bit Score: 413.67  E-value: 4.14e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   37 LKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPD 116
Cdd:pfam02374   1 MRWIFFGGKGGVGKTTVSCATAVQLSEQGKKVLLVSTDPAHSLSDSFNQKFGHEPTKVKGVENLSAMEIDPQMELEEYRG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  117 EFFEEDN---MLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQI 193
Cdd:pfam02374  81 EVQKPINailGLDMLEGILAEELSSLPGIDEIASFDEFKKYMDEGEYDVVIFDTAPTGHTLRLLSLPTVLSWYLEKIVKL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  194 KNQISPFISQMCNMlGLGDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTH 273
Cdd:pfam02374 161 KNQIGPLAKPFKGM-GMGGSCLPEALESLEETKEQIEKAREILSDPERTSFRLVCIPEKMSLYETERAIQELAKYGIDVD 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 213512072  274 NIIVNQlVFPDPEKpCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLE 340
Cdd:pfam02374 240 AVIVNQ-VLPETEQ-CPFCEARKKIQQKYLKEIEELFSDLPVAKLPLLPEEVVGLEALEKFSQFLYG 304
 
Name Accession Description Interval E-value
ArsA_ATPase pfam02374
Anion-transporting ATPase; This Pfam family represents a conserved domain, which is sometimes ...
37-340 4.14e-144

Anion-transporting ATPase; This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.


Pssm-ID: 280525  Cd Length: 304  Bit Score: 413.67  E-value: 4.14e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   37 LKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPD 116
Cdd:pfam02374   1 MRWIFFGGKGGVGKTTVSCATAVQLSEQGKKVLLVSTDPAHSLSDSFNQKFGHEPTKVKGVENLSAMEIDPQMELEEYRG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  117 EFFEEDN---MLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQI 193
Cdd:pfam02374  81 EVQKPINailGLDMLEGILAEELSSLPGIDEIASFDEFKKYMDEGEYDVVIFDTAPTGHTLRLLSLPTVLSWYLEKIVKL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  194 KNQISPFISQMCNMlGLGDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTH 273
Cdd:pfam02374 161 KNQIGPLAKPFKGM-GMGGSCLPEALESLEETKEQIEKAREILSDPERTSFRLVCIPEKMSLYETERAIQELAKYGIDVD 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 213512072  274 NIIVNQlVFPDPEKpCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLE 340
Cdd:pfam02374 240 AVIVNQ-VLPETEQ-CPFCEARKKIQQKYLKEIEELFSDLPVAKLPLLPEEVVGLEALEKFSQFLYG 304
GET3_arsA_TRC40 TIGR00345
transport-energizing ATPase, TRC40/GET3/ArsA family; Members of this family are ATPases that ...
54-338 3.09e-81

transport-energizing ATPase, TRC40/GET3/ArsA family; Members of this family are ATPases that energize transport, although with different partner proteins for different functions. Recent findings show that TRC40 (GET3 in yeast) in involved in the insertion of tail-anchored membrane proteins in eukaryotes. A similar function is expected for members of this family in archaea. However, the earliest discovery of a function for this protein family is ArsA, an arsenic resistance protein that partners with ArsB (see pfam02040) for As(III) efflux. [Hypothetical proteins, Conserved]


Pssm-ID: 273027  Cd Length: 284  Bit Score: 252.40  E-value: 3.09e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   54 SCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMGKKMMQ 133
Cdd:TIGR00345   2 SAATAIRLAEQGKKVLLVSTDPAHSLSDVFEQEIGHTPTKVTGVENLSAVEIDPQAALEEYRAKLVEQIKGNLPDGDMLG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  134 EAMSAF---PGIDEAMSYAEVMRLVK--GMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPfisqMCNML 208
Cdd:TIGR00345  82 DQLEGAalsPGIDEIAAFDEFLKHMTdaENEFDVVIFDTAPTGHTLRLLQLPEVLSSFLEKFIKIRSKLGP----MAKLF 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  209 GlGDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEkp 288
Cdd:TIGR00345 158 M-GAGEDDEALEKLEELKEQIEAAREILSDPERTSFVLVVIPEKMSLYESERAHKELAKYGIKVDAVIVNQVLPENAQ-- 234
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|
gi 213512072  289 CKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALL 338
Cdd:TIGR00345 235 DEFCQARWELQQKYLKQIPEKFADLPVAEVPLQKEEMVGLEALKRLSKTL 284
ArsA cd02035
ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ...
53-318 1.66e-74

ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.


Pssm-ID: 238992  Cd Length: 217  Bit Score: 232.91  E-value: 1.66e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  53 CSCSLAVQLSKGRESVLIISTDPAHNISDafdqkfskvptkvKGYDNLFAM------EIDPSLGVAELPDEFFEEDNMLS 126
Cdd:cd02035   15 IAAATAVRLAEEGKKVLLVSTDPAHNLSD-------------KGLPNLSDAfivedpEIAPNLYREEVDATRRVERAWGG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 127 MGKkMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLnfptiverglgrlmqiknqispfisqmcn 206
Cdd:cd02035   82 EGG-LMLELAAALPGIEELASLLAVFREFSEGLYDVIVFDTAPTGHTLRLL----------------------------- 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 207 mlglgdmnadqlaskleetlpvirsVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQlVFPDPE 286
Cdd:cd02035  132 -------------------------VRELLTDPERTSFRLVTLPEKLPLYETERAITELALYGIPVDAVVVNR-VLPAEV 185
                        250       260       270
                 ....*....|....*....|....*....|..
gi 213512072 287 KPCKMCEARHKIQAKYLDQMEDLYEDFHIVKL 318
Cdd:cd02035  186 DDDPFLAARRQIQQKYLAEIEELFDDLPIVPV 217
ArsA COG0003
Anion-transporting ATPase, ArsA/GET3 family [Inorganic ion transport and metabolism];
48-347 3.71e-64

Anion-transporting ATPase, ArsA/GET3 family [Inorganic ion transport and metabolism];


Pssm-ID: 223082  Cd Length: 322  Bit Score: 209.52  E-value: 3.71e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  48 VGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKgyDNLFAMEIDPSL---GVAELPDEFFEEDNM 124
Cdd:COG0003   13 VGKTTIAAATAVKLAESGKKVLLVSTDPAHSLGDVFDLELGHDPRKVG--PNLDALELDPEKaleEYWDEVKDYLARLLR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 125 LSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLmqIKNQISPFISQM 204
Cdd:COG0003   91 TRGLGGIYADELATLPGIDEALALLKILEYYVSGEYDVIVVDTAPTGHTLRLLSLPEVLGWYLEKL--FKPRRKRMVKAL 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 205 CNMLGL--GDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQlVF 282
Cdd:COG0003  169 KSLSTAagSPLPDDAVLEALEELKERIADVREVLTNPDGTSFRLVSIPEKLSLYETKRAVERLSLYGIPVDAVIVNK-IL 247
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 213512072 283 PDpEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLlepYKPPST 347
Cdd:COG0003  248 PD-EADQPFLEARRKIQQKYLKELEETFSDLAVVKVPLLAEEPVGLEALEKLGDLL---YGDESP 308
 
Name Accession Description Interval E-value
ArsA_ATPase pfam02374
Anion-transporting ATPase; This Pfam family represents a conserved domain, which is sometimes ...
37-340 4.14e-144

Anion-transporting ATPase; This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.


Pssm-ID: 280525  Cd Length: 304  Bit Score: 413.67  E-value: 4.14e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   37 LKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPD 116
Cdd:pfam02374   1 MRWIFFGGKGGVGKTTVSCATAVQLSEQGKKVLLVSTDPAHSLSDSFNQKFGHEPTKVKGVENLSAMEIDPQMELEEYRG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  117 EFFEEDN---MLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQI 193
Cdd:pfam02374  81 EVQKPINailGLDMLEGILAEELSSLPGIDEIASFDEFKKYMDEGEYDVVIFDTAPTGHTLRLLSLPTVLSWYLEKIVKL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  194 KNQISPFISQMCNMlGLGDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTH 273
Cdd:pfam02374 161 KNQIGPLAKPFKGM-GMGGSCLPEALESLEETKEQIEKAREILSDPERTSFRLVCIPEKMSLYETERAIQELAKYGIDVD 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 213512072  274 NIIVNQlVFPDPEKpCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLE 340
Cdd:pfam02374 240 AVIVNQ-VLPETEQ-CPFCEARKKIQQKYLKEIEELFSDLPVAKLPLLPEEVVGLEALEKFSQFLYG 304
GET3_arsA_TRC40 TIGR00345
transport-energizing ATPase, TRC40/GET3/ArsA family; Members of this family are ATPases that ...
54-338 3.09e-81

transport-energizing ATPase, TRC40/GET3/ArsA family; Members of this family are ATPases that energize transport, although with different partner proteins for different functions. Recent findings show that TRC40 (GET3 in yeast) in involved in the insertion of tail-anchored membrane proteins in eukaryotes. A similar function is expected for members of this family in archaea. However, the earliest discovery of a function for this protein family is ArsA, an arsenic resistance protein that partners with ArsB (see pfam02040) for As(III) efflux. [Hypothetical proteins, Conserved]


Pssm-ID: 273027  Cd Length: 284  Bit Score: 252.40  E-value: 3.09e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   54 SCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMGKKMMQ 133
Cdd:TIGR00345   2 SAATAIRLAEQGKKVLLVSTDPAHSLSDVFEQEIGHTPTKVTGVENLSAVEIDPQAALEEYRAKLVEQIKGNLPDGDMLG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  134 EAMSAF---PGIDEAMSYAEVMRLVK--GMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPfisqMCNML 208
Cdd:TIGR00345  82 DQLEGAalsPGIDEIAAFDEFLKHMTdaENEFDVVIFDTAPTGHTLRLLQLPEVLSSFLEKFIKIRSKLGP----MAKLF 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  209 GlGDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEkp 288
Cdd:TIGR00345 158 M-GAGEDDEALEKLEELKEQIEAAREILSDPERTSFVLVVIPEKMSLYESERAHKELAKYGIKVDAVIVNQVLPENAQ-- 234
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|
gi 213512072  289 CKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALL 338
Cdd:TIGR00345 235 DEFCQARWELQQKYLKQIPEKFADLPVAEVPLQKEEMVGLEALKRLSKTL 284
ArsA cd02035
ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ...
53-318 1.66e-74

ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.


Pssm-ID: 238992  Cd Length: 217  Bit Score: 232.91  E-value: 1.66e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  53 CSCSLAVQLSKGRESVLIISTDPAHNISDafdqkfskvptkvKGYDNLFAM------EIDPSLGVAELPDEFFEEDNMLS 126
Cdd:cd02035   15 IAAATAVRLAEEGKKVLLVSTDPAHNLSD-------------KGLPNLSDAfivedpEIAPNLYREEVDATRRVERAWGG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 127 MGKkMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLnfptiverglgrlmqiknqispfisqmcn 206
Cdd:cd02035   82 EGG-LMLELAAALPGIEELASLLAVFREFSEGLYDVIVFDTAPTGHTLRLL----------------------------- 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 207 mlglgdmnadqlaskleetlpvirsVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQlVFPDPE 286
Cdd:cd02035  132 -------------------------VRELLTDPERTSFRLVTLPEKLPLYETERAITELALYGIPVDAVVVNR-VLPAEV 185
                        250       260       270
                 ....*....|....*....|....*....|..
gi 213512072 287 KPCKMCEARHKIQAKYLDQMEDLYEDFHIVKL 318
Cdd:cd02035  186 DDDPFLAARRQIQQKYLAEIEELFDDLPIVPV 217
ArsA COG0003
Anion-transporting ATPase, ArsA/GET3 family [Inorganic ion transport and metabolism];
48-347 3.71e-64

Anion-transporting ATPase, ArsA/GET3 family [Inorganic ion transport and metabolism];


Pssm-ID: 223082  Cd Length: 322  Bit Score: 209.52  E-value: 3.71e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  48 VGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKgyDNLFAMEIDPSL---GVAELPDEFFEEDNM 124
Cdd:COG0003   13 VGKTTIAAATAVKLAESGKKVLLVSTDPAHSLGDVFDLELGHDPRKVG--PNLDALELDPEKaleEYWDEVKDYLARLLR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 125 LSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLmqIKNQISPFISQM 204
Cdd:COG0003   91 TRGLGGIYADELATLPGIDEALALLKILEYYVSGEYDVIVVDTAPTGHTLRLLSLPEVLGWYLEKL--FKPRRKRMVKAL 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072 205 CNMLGL--GDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQlVF 282
Cdd:COG0003  169 KSLSTAagSPLPDDAVLEALEELKERIADVREVLTNPDGTSFRLVSIPEKLSLYETKRAVERLSLYGIPVDAVIVNK-IL 247
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 213512072 283 PDpEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLlepYKPPST 347
Cdd:COG0003  248 PD-EADQPFLEARRKIQQKYLKELEETFSDLAVVKVPLLAEEPVGLEALEKLGDLL---YGDESP 308
arsen_driv_ArsA TIGR04291
arsenical pump-driving ATPase; The broader family (TIGR00345) to which the current family ...
54-330 5.65e-25

arsenical pump-driving ATPase; The broader family (TIGR00345) to which the current family belongs consists of transport-energizing ATPases, including to TRC40/GET3 family involved in post-translational insertion of protein C-terminal transmembrane anchors into membranes from the cyotosolic face. This family, however, is restricted to ATPases that energize pumps that export arsenite (or antimonite).


Pssm-ID: 275109  Cd Length: 566  Bit Score: 105.94  E-value: 5.65e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   54 SCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAE------------LPDEFFEE 121
Cdd:TIGR04291  20 ACATAINLADQGKRVLLVSTDPASNVGQVFGQTIGNKITAIAGVPGLFALEIDPQAAAQAyrarivdpvrgvLPDDVVSS 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  122 dnmlsmgkkmMQEAMS--------AFPGIDEAMSYAEVMRlvkgmNFSVVVFDTAPTGHTLRLLNFPtiverglgrlmqi 193
Cdd:TIGR04291 100 ----------IEEQLSgactteiaAFDEFTGLLTDAELTQ-----DFDHIIFDTAPTGHTIRLLQLP------------- 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  194 kNQISPFISQMCNmlglGDMNADQLASkLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTH 273
Cdd:TIGR04291 152 -GAWSDFLDTNPN----GASCLGPLAG-LEKQRAQYAKAVEALSDPERTRLILVARPQKSTLLEVARTHQELAAIGLKNQ 225
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 213512072  274 NIIVNQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADK 330
Cdd:TIGR04291 226 YLVINGVLPETEASDDPLAQAIYKREQKALQHMPAILANLPRYTLPLKPYNLVGLEA 282
arsen_driv_ArsA TIGR04291
arsenical pump-driving ATPase; The broader family (TIGR00345) to which the current family ...
18-324 3.83e-12

arsenical pump-driving ATPase; The broader family (TIGR00345) to which the current family belongs consists of transport-energizing ATPases, including to TRC40/GET3 family involved in post-translational insertion of protein C-terminal transmembrane anchors into membranes from the cyotosolic face. This family, however, is restricted to ATPases that energize pumps that export arsenite (or antimonite).


Pssm-ID: 275109  Cd Length: 566  Bit Score: 67.04  E-value: 3.83e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   18 APDVEPLePTLSNII---EQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFskvptkv 94
Cdd:TIGR04291 300 TPQVPDL-PSLSRLIdeiAKSEKGLIMTMGKGGVGKTTVAAAIAVRLANKGLDVHLTTSDPAAHLSVTLTGSL------- 371
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072   95 kgyDNLFAMEIDPSLGVAELPDEFFEE--DNMLSMGKKMMQEAMSAfPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGH 172
Cdd:TIGR04291 372 ---NNLQVSRIDPKQETERYRQEVLATkgKELDEDGKAYLEEDLRS-PCTEEIAVFQAFSRIIREAGDRFVVMDTAPTGH 447
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 213512072  173 TLRLLNFPTIVERGLGRLMqiknqispfisqmcnmlglgdmnaDQLASKLEETLPvirsvseQFKDPEQTTFICVCIAEF 252
Cdd:TIGR04291 448 TLLLLDATGAYHREVERKM------------------------GDTPEHVTTPMM-------QLQDPERTKVLLVTLPET 496
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 213512072  253 LSLYETERLIQELAKCKIDTHNIIVNQ-LVFPDPEKPCKMCEARHKIqaKYLDQMEDLYEDfHIVKLPLLPHE 324
Cdd:TIGR04291 497 TPVLEAARLQEDLRRAGIEPWWWVINNsLAATNTTSPLLSQRAQNEL--KWIEKVKRIHAD-RYAVIPLQAEE 566
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH