NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|194352380|gb|ACF54603|]
View 

nonstructural protein 1 [Influenza A virus (A/WSN/1933(H1N1))]

Protein Classification

Flu_NS1 domain-containing protein (domain architecture ID 10457087)

Flu_NS1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Flu_NS1 pfam00600
Influenza non-structural protein (NS1); NS1 is a homodimeric RNA-binding protein that is ...
1-216 4.77e-162

Influenza non-structural protein (NS1); NS1 is a homodimeric RNA-binding protein that is required for viral replication. NS1 binds polyA tails of mRNA keeping them in the nucleus. NS1 inhibits pre-mRNA splicing by tightly binding to a specific stem-bulge of U6 snRNA.


:

Pssm-ID: 278995  Cd Length: 216  Bit Score: 450.98  E-value: 4.77e-162
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194352380    1 MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMT 80
Cdd:pfam00600   1 MDSNTVSSFQVDCFLWHVRKRLADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194352380   81 MASVPASRYLTDMTLEEMSRHWFMLMPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGTIVGEI 160
Cdd:pfam00600  81 IASVPASRYLTDMTLEEMSRDWYMLMPKQKVAGGLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEI 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 194352380  161 SPLPSLPGHTDEDVKNAVGVLIGGLEWNNNTVRVSETLQRFAWRSSNENGRPPLTP 216
Cdd:pfam00600 161 SPLPSLPGHTTEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLPP 216
 
Name Accession Description Interval E-value
Flu_NS1 pfam00600
Influenza non-structural protein (NS1); NS1 is a homodimeric RNA-binding protein that is ...
1-216 4.77e-162

Influenza non-structural protein (NS1); NS1 is a homodimeric RNA-binding protein that is required for viral replication. NS1 binds polyA tails of mRNA keeping them in the nucleus. NS1 inhibits pre-mRNA splicing by tightly binding to a specific stem-bulge of U6 snRNA.


Pssm-ID: 278995  Cd Length: 216  Bit Score: 450.98  E-value: 4.77e-162
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194352380    1 MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMT 80
Cdd:pfam00600   1 MDSNTVSSFQVDCFLWHVRKRLADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194352380   81 MASVPASRYLTDMTLEEMSRHWFMLMPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGTIVGEI 160
Cdd:pfam00600  81 IASVPASRYLTDMTLEEMSRDWYMLMPKQKVAGGLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEI 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 194352380  161 SPLPSLPGHTDEDVKNAVGVLIGGLEWNNNTVRVSETLQRFAWRSSNENGRPPLTP 216
Cdd:pfam00600 161 SPLPSLPGHTTEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLPP 216
 
Name Accession Description Interval E-value
Flu_NS1 pfam00600
Influenza non-structural protein (NS1); NS1 is a homodimeric RNA-binding protein that is ...
1-216 4.77e-162

Influenza non-structural protein (NS1); NS1 is a homodimeric RNA-binding protein that is required for viral replication. NS1 binds polyA tails of mRNA keeping them in the nucleus. NS1 inhibits pre-mRNA splicing by tightly binding to a specific stem-bulge of U6 snRNA.


Pssm-ID: 278995  Cd Length: 216  Bit Score: 450.98  E-value: 4.77e-162
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194352380    1 MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMT 80
Cdd:pfam00600   1 MDSNTVSSFQVDCFLWHVRKRLADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194352380   81 MASVPASRYLTDMTLEEMSRHWFMLMPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGTIVGEI 160
Cdd:pfam00600  81 IASVPASRYLTDMTLEEMSRDWYMLMPKQKVAGGLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEI 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 194352380  161 SPLPSLPGHTDEDVKNAVGVLIGGLEWNNNTVRVSETLQRFAWRSSNENGRPPLTP 216
Cdd:pfam00600 161 SPLPSLPGHTTEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLPP 216
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH