NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|18859301|ref|NP_571519|]
View 

guanine nucleotide-binding protein subunit beta-2-like 1 [Danio rerio]

Protein Classification

WD40 domain-containing protein (domain architecture ID 10077586)

WD40 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
8-311 3.23e-94

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


:

Pssm-ID: 238121  Cd Length: 289  Bit Score: 284.61  E-value: 3.23e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   8 RGTLKGHSGWVTQIATTPQfPDMILSASRDKTIIMWKLTRDEtnygiPQRALRGHSHFVSDVVISSDGQFALSGSWDGTL 87
Cdd:cd00200   2 RRTLKGHTGGVTCVAFSPD-GKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDKTI 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  88 RLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTL-GVCKYTIQDdsHTEWVSCVRFSPNssNPIIV 166
Cdd:cd00200  76 RLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVEtGKCLTTLRG--HTDWVNSVAFSPD--GTFVA 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 167 SCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG-GDTINALCFSPNR 245
Cdd:cd00200 152 SSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAFSPDG 231
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 18859301 246 YWLCAATG-PSIKIWDLEGKIIVDELrqdiittnsKAEPPQCTSLAWSADGQTLFAGYTDNLIRVWQ 311
Cdd:cd00200 232 YLLASGSEdGTIRVWDLRTGECVQTL---------SGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
8-311 3.23e-94

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121  Cd Length: 289  Bit Score: 284.61  E-value: 3.23e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   8 RGTLKGHSGWVTQIATTPQfPDMILSASRDKTIIMWKLTRDEtnygiPQRALRGHSHFVSDVVISSDGQFALSGSWDGTL 87
Cdd:cd00200   2 RRTLKGHTGGVTCVAFSPD-GKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDKTI 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  88 RLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTL-GVCKYTIQDdsHTEWVSCVRFSPNssNPIIV 166
Cdd:cd00200  76 RLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVEtGKCLTTLRG--HTDWVNSVAFSPD--GTFVA 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 167 SCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG-GDTINALCFSPNR 245
Cdd:cd00200 152 SSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAFSPDG 231
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 18859301 246 YWLCAATG-PSIKIWDLEGKIIVDELrqdiittnsKAEPPQCTSLAWSADGQTLFAGYTDNLIRVWQ 311
Cdd:cd00200 232 YLLASGSEdGTIRVWDLRTGECVQTL---------SGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 COG2319
WD40 repeat [General function prediction only];
10-310 3.28e-41

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 151.01  E-value: 3.28e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  10 TLKGHSGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDEtnygiPQRALRGHSHFVSDVVISSDGQF-ALSGSWDGTLR 88
Cdd:COG2319 150 TLEGHSESVTSLAFSPDGKLLASGSSLDGTIKLWDLRTGK-----PLSTLAGHTDPVSSLAFSPDGGLlIASGSSDGTIR 224
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  89 LWDLTTGTTTR-RFVGHTKDVLSvAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDDSHTEWVSCVRFSPNSSnpIIVS 167
Cdd:COG2319 225 LWDLSTGKLLRsTLSGHSDSVVS-SFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSPDGK--LLAS 301
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 168 CGWDKMVKVWNLAN--CKLKTNHIGHTGYLNTVTVSPDGSLCASGG-KDGQAMLWDLNEGKHLYTLDGGDTINALCFSPN 244
Cdd:COG2319 302 GSSDGTVRLWDLETgkLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGsDDGTIRLWDLRTGKPLKTLEGHSNVLSVSFSPD 381
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 18859301 245 RYWLC-AATGPSIKIWDLEGKIIVDELRQDIITTnskaeppqcTSLAWSADGQTLFAGYTDNLIRVW 310
Cdd:COG2319 382 GRVVSsGSTDGTVRLWDLSTGSLLRNLDGHTSRV---------TSLDFSPDGKSLASGSSDNTIRLW 439
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
80-222 1.59e-09

protein SPA1-RELATED; Provisional


Pssm-ID: 177776  Cd Length: 793  Bit Score: 58.94  E-value: 1.59e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAF-SADNRQIVSGSRDKTIKLWN-TLGVCKYTIQDDSHtewVSCVRFs 157
Cdd:PLN00181 550 SSNFEGVVQVWDVARSQLVTEMKEHEKRVWSIDYsSADPTLLASGSDDGSVKLWSiNQGVSIGTIKTKAN---ICCVQF- 625
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 18859301  158 PNSSNPIIVSCGWDKMVKVWNLANCKLK-TNHIGHTGYLNTVTVSpDGSLCASGGKDGQAMLWDLN 222
Cdd:PLN00181 626 PSESGRSLAFGSADHKVYYYDLRNPKLPlCTMIGHSKTVSYVRFV-DSSTLVSSSTDNTLKLWDLS 690
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
94-133 7.69e-08

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 49.23  E-value: 7.69e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 18859301     94 TGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWN 133
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
95-133 1.24e-07

WD domain, G-beta repeat;


Pssm-ID: 306830  Cd Length: 39  Bit Score: 48.51  E-value: 1.24e-07
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 18859301    95 GTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWN 133
Cdd:pfam00400   1 GKLLKTLKGHTSGVTSLAFSPDGKLLASGSDDGTVKLWD 39
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
8-311 3.23e-94

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121  Cd Length: 289  Bit Score: 284.61  E-value: 3.23e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   8 RGTLKGHSGWVTQIATTPQfPDMILSASRDKTIIMWKLTRDEtnygiPQRALRGHSHFVSDVVISSDGQFALSGSWDGTL 87
Cdd:cd00200   2 RRTLKGHTGGVTCVAFSPD-GKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDKTI 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  88 RLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTL-GVCKYTIQDdsHTEWVSCVRFSPNssNPIIV 166
Cdd:cd00200  76 RLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVEtGKCLTTLRG--HTDWVNSVAFSPD--GTFVA 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 167 SCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG-GDTINALCFSPNR 245
Cdd:cd00200 152 SSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAFSPDG 231
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 18859301 246 YWLCAATG-PSIKIWDLEGKIIVDELrqdiittnsKAEPPQCTSLAWSADGQTLFAGYTDNLIRVWQ 311
Cdd:cd00200 232 YLLASGSEdGTIRVWDLRTGECVQTL---------SGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 COG2319
WD40 repeat [General function prediction only];
10-310 3.28e-41

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 151.01  E-value: 3.28e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  10 TLKGHSGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDEtnygiPQRALRGHSHFVSDVVISSDGQF-ALSGSWDGTLR 88
Cdd:COG2319 150 TLEGHSESVTSLAFSPDGKLLASGSSLDGTIKLWDLRTGK-----PLSTLAGHTDPVSSLAFSPDGGLlIASGSSDGTIR 224
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  89 LWDLTTGTTTR-RFVGHTKDVLSvAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDDSHTEWVSCVRFSPNSSnpIIVS 167
Cdd:COG2319 225 LWDLSTGKLLRsTLSGHSDSVVS-SFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSPDGK--LLAS 301
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 168 CGWDKMVKVWNLAN--CKLKTNHIGHTGYLNTVTVSPDGSLCASGG-KDGQAMLWDLNEGKHLYTLDGGDTINALCFSPN 244
Cdd:COG2319 302 GSSDGTVRLWDLETgkLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGsDDGTIRLWDLRTGKPLKTLEGHSNVLSVSFSPD 381
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 18859301 245 RYWLC-AATGPSIKIWDLEGKIIVDELRQDIITTnskaeppqcTSLAWSADGQTLFAGYTDNLIRVW 310
Cdd:COG2319 382 GRVVSsGSTDGTVRLWDLSTGSLLRNLDGHTSRV---------TSLDFSPDGKSLASGSSDNTIRLW 439
WD40 COG2319
WD40 repeat [General function prediction only];
10-283 1.51e-38

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 143.69  E-value: 1.51e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  10 TLKGHSGWVTQIATTPQFPDMILSASRDKTIIMWkltrDETNYGIPQRALRGHSHFVSDVViSSDGQFALSGSWDGTLRL 89
Cdd:COG2319 193 TLAGHTDPVSSLAFSPDGGLLIASGSSDGTIRLW----DLSTGKLLRSTLSGHSDSVVSSF-SPDGSLLASGSSDGTIRL 267
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  90 WDL-TTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNT-LGVCKYTIQDDSHTEWVSCVRFSPNSSNpIIVS 167
Cdd:COG2319 268 WDLrSSSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLeTGKLLSSLTLKGHEGPVSSLSFSPDGSL-LVSG 346
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 168 CGWDKMVKVWNLANCKLKTNHIGHTGyLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG-GDTINALCFSPN-R 245
Cdd:COG2319 347 GSDDGTIRLWDLRTGKPLKTLEGHSN-VLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRNLDGhTSRVTSLDFSPDgK 425
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 18859301 246 YWLCAATGPSIKIWDLEGKIIVDELRQDIITTNSKAEP 283
Cdd:COG2319 426 SLASGSSDNTIRLWDLKTSLKSVSFSPDGKVLASKSSD 463
WD40 COG2319
WD40 repeat [General function prediction only];
32-312 7.15e-33

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 127.13  E-value: 7.15e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  32 LSASRDKTIIMWKLTRDET--NYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTT----------- 98
Cdd:COG2319  32 SLGSSESGILLLALLSDSLvsLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGEKLiksleglhdss 111
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  99 -------------------------------------RRFVGHTKDVLSVAFSADNRQIVSGSR-DKTIKLWNTLGVCKY 140
Cdd:COG2319 112 vsklalsspdgnsillasssldgtvklwdlstpgkliRTLEGHSESVTSLAFSPDGKLLASGSSlDGTIKLWDLRTGKPL 191
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 141 TIQDDsHTEWVSCVRFSPNsSNPIIVSCGWDKMVKVWNLANCKLKTNHI-GHTGYLNTVtVSPDGSLCASGGKDGQAMLW 219
Cdd:COG2319 192 STLAG-HTDPVSSLAFSPD-GGLLIASGSSDGTIRLWDLSTGKLLRSTLsGHSDSVVSS-FSPDGSLLASGSSDGTIRLW 268
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 220 DLNEGKHLYTLDGGDT--INALCFSPN-RYWLCAATGPSIKIWDLEGKIIVDELRQDIITTnskaeppQCTSLAWSADGQ 296
Cdd:COG2319 269 DLRSSSSLLRTLSGHSssVLSVAFSPDgKLLASGSSDGTVRLWDLETGKLLSSLTLKGHEG-------PVSSLSFSPDGS 341
                       330
                ....*....|....*..
gi 18859301 297 TLFAGY-TDNLIRVWQV 312
Cdd:COG2319 342 LLVSGGsDDGTIRLWDL 358
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
2-133 1.84e-26

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121  Cd Length: 289  Bit Score: 106.65  E-value: 1.84e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   2 TEQMTVRGTLKGHSGWVTQIATTPQfPDMILSASRDKTIIMWkltrdETNYGIPQRALRGHSHFVSDVVISSDGQFALSG 81
Cdd:cd00200 164 LRTGKCVATLTGHTGEVNSVAFSPD-GEKLLSSSSDGTIKLW-----DLSTGKCLGTLRGHENGVNSVAFSPDGYLLASG 237
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|..
gi 18859301  82 SWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWN 133
Cdd:cd00200 238 SEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 COG2319
WD40 repeat [General function prediction only];
62-310 1.06e-25

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 106.33  E-value: 1.06e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  62 HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWN-TLGVCKY 140
Cdd:COG2319  22 GPSLNSLSLLSLGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDlDNGEKLI 101
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 141 TIQDDSHTEWVSCVRFSPNSSNPIIVSCGW-DKMVKVWNLANC-KLKTNHIGHTGYLNTVTVSPDGSLCASGG-KDGQAM 217
Cdd:COG2319 102 KSLEGLHDSSVSKLALSSPDGNSILLASSSlDGTVKLWDLSTPgKLIRTLEGHSESVTSLAFSPDGKLLASGSsLDGTIK 181
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301 218 LWDLNEGKHLYTLDG-GDTINALCFSPNRYWLCAATGP--SIKIWDLE-GKIIVDELRQDIITTNSkaeppqctslAWSA 293
Cdd:COG2319 182 LWDLRTGKPLSTLAGhTDPVSSLAFSPDGGLLIASGSSdgTIRLWDLStGKLLRSTLSGHSDSVVS----------SFSP 251
                       250
                ....*....|....*..
gi 18859301 294 DGQTLFAGYTDNLIRVW 310
Cdd:COG2319 252 DGSLLASGSSDGTIRLW 268
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
80-222 1.59e-09

protein SPA1-RELATED; Provisional


Pssm-ID: 177776  Cd Length: 793  Bit Score: 58.94  E-value: 1.59e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAF-SADNRQIVSGSRDKTIKLWN-TLGVCKYTIQDDSHtewVSCVRFs 157
Cdd:PLN00181 550 SSNFEGVVQVWDVARSQLVTEMKEHEKRVWSIDYsSADPTLLASGSDDGSVKLWSiNQGVSIGTIKTKAN---ICCVQF- 625
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 18859301  158 PNSSNPIIVSCGWDKMVKVWNLANCKLK-TNHIGHTGYLNTVTVSpDGSLCASGGKDGQAMLWDLN 222
Cdd:PLN00181 626 PSESGRSLAFGSADHKVYYYDLRNPKLPlCTMIGHSKTVSYVRFV-DSSTLVSSSTDNTLKLWDLS 690
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
108-314 3.96e-09

protein SPA1-RELATED; Provisional


Pssm-ID: 177776  Cd Length: 793  Bit Score: 57.40  E-value: 3.96e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  108 VLSVAFSADNRQIVSGSRDKTIKLWNtlgvCKYTIQD--DSHTEWVSCVRFSPNSS-------NPIIVSCGWDKMVKVWN 178
Cdd:PLN00181 486 VCAIGFDRDGEFFATAGVNKKIKIFE----CESIIKDgrDIHYPVVELASRSKLSGicwnsyiKSQVASSNFEGVVQVWD 561
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  179 LANCKLKTNHIGHTGYLNTVTVSP-DGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSpnrywlcAATGPSIK 257
Cdd:PLN00181 562 VARSQLVTEMKEHEKRVWSIDYSSaDPTLLASGSDDGSVKLWSINQGVSIGTIKTKANICCVQFP-------SESGRSLA 634
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18859301  258 IWDLEGKIIVDELRQDIIttnskaepPQCTSLAWS--------ADGQTLFAGYTDNLIRVWQVTI 314
Cdd:PLN00181 635 FGSADHKVYYYDLRNPKL--------PLCTMIGHSktvsyvrfVDSSTLVSSSTDNTLKLWDLSM 691
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
94-133 7.69e-08

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 49.23  E-value: 7.69e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 18859301     94 TGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWN 133
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
95-133 1.24e-07

WD domain, G-beta repeat;


Pssm-ID: 306830  Cd Length: 39  Bit Score: 48.51  E-value: 1.24e-07
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 18859301    95 GTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWN 133
Cdd:pfam00400   1 GKLLKTLKGHTSGVTSLAFSPDGKLLASGSDDGTVKLWD 39
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
31-219 2.37e-07

protein SPA1-RELATED; Provisional


Pssm-ID: 177776  Cd Length: 793  Bit Score: 52.01  E-value: 2.37e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   31 ILSASRDKTIIMWKLTRDETnygipQRALRGHSHFVSDVVISS-DGQFALSGSWDGTLRLWDLTTGTTtrrfVGHTK--- 106
Cdd:PLN00181 548 VASSNFEGVVQVWDVARSQL-----VTEMKEHEKRVWSIDYSSaDPTLLASGSDDGSVKLWSINQGVS----IGTIKtka 618
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  107 DVLSVAFSADN-RQIVSGSRDKTIKLWN----TLGVCKYTiqddSHTEWVSCVRFSPNSSnpiIVSCGWDKMVKVWNLAN 181
Cdd:PLN00181 619 NICCVQFPSESgRSLAFGSADHKVYYYDlrnpKLPLCTMI----GHSKTVSYVRFVDSST---LVSSSTDNTLKLWDLSM 691
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 18859301  182 CKLKTNH------IGHTGYLNTVTVSPDGSLCASGGKDGQAMLW 219
Cdd:PLN00181 692 SISGINEtplhsfMGHTNVKNFVGLSVSDGYIATGSETNEVFVY 735
WD40 pfam00400
WD domain, G-beta repeat;
53-91 3.95e-07

WD domain, G-beta repeat;


Pssm-ID: 306830  Cd Length: 39  Bit Score: 46.97  E-value: 3.95e-07
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 18859301    53 GIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWD 91
Cdd:pfam00400   1 GKLLKTLKGHTSGVTSLAFSPDGKLLASGSDDGTVKLWD 39
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
53-91 1.43e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 45.38  E-value: 1.43e-06
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 18859301     53 GIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWD 91
Cdd:smart00320   2 GELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
PTZ00421 PTZ00421
coronin; Provisional
102-213 9.51e-06

coronin; Provisional


Pssm-ID: 173611  Cd Length: 493  Bit Score: 46.81  E-value: 9.51e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301  102 VGHTKDVLSVAFSA-DNRQIVSGSRDKTIKLWN------TLGVCKYTIQDDSHTEWVSCVRFSPnSSNPIIVSCGWDKMV 174
Cdd:PTZ00421  72 LGQEGPIIDVAFNPfDPQKLFTASEDGTIMGWGipeeglTQNISDPIVHLQGHTKKVGIVSFHP-SAMNVLASAGADMVV 150
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 18859301  175 KVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKD 213
Cdd:PTZ00421 151 NVWDVERGKAVEVIKCHSDQITSLEWNLDGSLLCTTSKD 189
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
136-178 2.22e-05

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 42.30  E-value: 2.22e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 18859301    136 GVCKYTIQddSHTEWVSCVRFSPNSSnpIIVSCGWDKMVKVWN 178
Cdd:smart00320   2 GELLKTLK--GHTGPVTSVAFSPDGK--YLASGSDDGTIKLWD 40
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
190-220 1.44e-04

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 39.99  E-value: 1.44e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 18859301    190 GHTGYLNTVTVSPDGSLCASGGKDGQAMLWD 220
Cdd:smart00320  10 GHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
136-178 1.58e-04

WD domain, G-beta repeat;


Pssm-ID: 306830  Cd Length: 39  Bit Score: 39.65  E-value: 1.58e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 18859301   136 GVCKYTIQddSHTEWVSCVRFSPNSSnpIIVSCGWDKMVKVWN 178
Cdd:pfam00400   1 GKLLKTLK--GHTSGVTSLAFSPDGK--LLASGSDDGTVKLWD 39
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
11-133 1.90e-04

protein SPA1-RELATED; Provisional


Pssm-ID: 177776  Cd Length: 793  Bit Score: 42.77  E-value: 1.90e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   11 LKGHSGWVTQIATTPQFPDMILSASRDKTIIMWKLtrdetNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLW 90
Cdd:PLN00181 571 MKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSI-----NQGVSIGTIKTKANICCVQFPSESGRSLAFGSADHKVYYY 645
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 18859301   91 DLTTGTTTR-RFVGHTKDVLSVAFsADNRQIVSGSRDKTIKLWN 133
Cdd:PLN00181 646 DLRNPKLPLcTMIGHSKTVSYVRF-VDSSTLVSSSTDNTLKLWD 688
PTZ00421 PTZ00421
coronin; Provisional
11-131 2.31e-04

coronin; Provisional


Pssm-ID: 173611  Cd Length: 493  Bit Score: 42.57  E-value: 2.31e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   11 LKGHSGWVTQIATTPQFPDMILSASRDKTIIMWKLTRD--ETNYGIPQRALRGHSHFVSDVVI--SSDGQFALSGSwDGT 86
Cdd:PTZ00421  71 LLGQEGPIIDVAFNPFDPQKLFTASEDGTIMGWGIPEEglTQNISDPIVHLQGHTKKVGIVSFhpSAMNVLASAGA-DMV 149
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 18859301   87 LRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL 131
Cdd:PTZ00421 150 VNVWDVERGKAVEVIKCHSDQITSLEWNLDGSLLCTTSKDKKLNI 194
WD40 pfam00400
WD domain, G-beta repeat;
183-220 4.15e-04

WD domain, G-beta repeat;


Pssm-ID: 306830  Cd Length: 39  Bit Score: 38.49  E-value: 4.15e-04
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 18859301   183 KLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWD 220
Cdd:pfam00400   2 KLLKTLKGHTSGVTSLAFSPDGKLLASGSDDGTVKLWD 39
PTZ00420 PTZ00420
coronin; Provisional
11-92 1.80e-03

coronin; Provisional


Pssm-ID: 240412  Cd Length: 568  Bit Score: 39.55  E-value: 1.80e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859301   11 LKGHSGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYG---IPQRALRGHSHFVSDVVISSDGQFAL-SGSWDGT 86
Cdd:PTZ00420  70 LKGHTSSILDLQFNPCFSEILASGSEDLTIRVWEIPHNDESVKeikDPQCILKGHKKKISIIDWNPMNYYIMcSSGFDSF 149

                 ....*.
gi 18859301   87 LRLWDL 92
Cdd:PTZ00420 150 VNIWDI 155
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
4-44 4.81e-03

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 35.37  E-value: 4.81e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 18859301      4 QMTVRGTLKGHSGWVTQIATTPQFpDMILSASRDKTIIMWK 44
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDG-KYLASGSDDGTIKLWD 40
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH