NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|18543293|ref|NP_570019|]
View 

csat, isoform A [Drosophila melanogaster]

Protein Classification

Nuc_sug_transp domain-containing protein (domain architecture ID 12050620)

Nuc_sug_transp domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Nuc_sug_transp pfam04142
Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars ...
7-331 8.94e-164

Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars from the cytoplasm into Golgi vesicles. SSLC35A1 transports CMP-sialic acid, SLC35A2 transports UDP-galactose and SLC35A3 transports UDP-GlcNAc.


:

Pssm-ID: 282054  Cd Length: 315  Bit Score: 464.51  E-value: 8.94e-164
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293     7 NANTLKYISLLTLTLQNAILGLSMRYARTR-PGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP 85
Cdd:pfam04142   1 NSSTFKYISLAVLTVQNASLVLTLRYSRTRkDGPRYFSTTAVLMAEIIKLVVCFLLLYKETKSDARKFLRELHKEIFNSP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293    86 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEG 165
Cdd:pfam04142  81 RDTLKVAVPSLIYTLQNNLLYVALSNLDAATYQVTYQLKILTTAIFSVLMLGRKLSTLQWMSLFLLMAGVALVQYQQASS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   166 PTSGSAGGAAaaataassggaPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVN 245
Cdd:pfam04142 161 PESESAAAAA-----------VEQNPILGLSAVLAACFSSGFAGVYFEKILKGSNVSLWIRNIQLALFGIIFALLGAWLY 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   246 DGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIA 325
Cdd:pfam04142 230 DGSRISEKGFFFGYTDVVWIVVLLQAVGGLVIAVVVKYADNILKGFATSLSIILSTVASVLLFDFFITLTFLLGAILVIA 309

                  ....*.
gi 18543293   326 SIFLYG 331
Cdd:pfam04142 310 AIFLYG 315
 
Name Accession Description Interval E-value
Nuc_sug_transp pfam04142
Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars ...
7-331 8.94e-164

Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars from the cytoplasm into Golgi vesicles. SSLC35A1 transports CMP-sialic acid, SLC35A2 transports UDP-galactose and SLC35A3 transports UDP-GlcNAc.


Pssm-ID: 282054  Cd Length: 315  Bit Score: 464.51  E-value: 8.94e-164
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293     7 NANTLKYISLLTLTLQNAILGLSMRYARTR-PGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP 85
Cdd:pfam04142   1 NSSTFKYISLAVLTVQNASLVLTLRYSRTRkDGPRYFSTTAVLMAEIIKLVVCFLLLYKETKSDARKFLRELHKEIFNSP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293    86 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEG 165
Cdd:pfam04142  81 RDTLKVAVPSLIYTLQNNLLYVALSNLDAATYQVTYQLKILTTAIFSVLMLGRKLSTLQWMSLFLLMAGVALVQYQQASS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   166 PTSGSAGGAAaaataassggaPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVN 245
Cdd:pfam04142 161 PESESAAAAA-----------VEQNPILGLSAVLAACFSSGFAGVYFEKILKGSNVSLWIRNIQLALFGIIFALLGAWLY 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   246 DGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIA 325
Cdd:pfam04142 230 DGSRISEKGFFFGYTDVVWIVVLLQAVGGLVIAVVVKYADNILKGFATSLSIILSTVASVLLFDFFITLTFLLGAILVIA 309

                  ....*.
gi 18543293   326 SIFLYG 331
Cdd:pfam04142 310 AIFLYG 315
nst TIGR00803
UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10) ...
90-330 3.94e-51

UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10)Nucleotide-sugar transporters (NSTs) are found in the Golgi apparatus and the endoplasmic reticulum of eukaryotic cells. Members of the family have been sequenced from yeast, protozoans and animals. Animals such as C. elegans possess many of these transporters. Humans have at least two closely related isoforms of the UDP-galactose:UMP exchange transporter.NSTs generally appear to function by antiport mechanisms, exchanging a nucleotide-sugar for a nucleotide. Thus, CMP-sialic acid is exchanged for CMP; GDP-mannose is preferentially exchanged for GMP, and UDP-galactose and UDP-N-acetylglucosamine are exchanged for UMP (or possibly UDP). Other nucleotide sugars (e.g., GDP-fucose, UDP-xylose, UDP-glucose, UDP-N-acetylgalactosamine, etc.) may also be transported in exchange for various nucleotides, but their transporters have not been molecularly characterized. Each compound appears to be translocated by its own transport protein. Transport allows the compound, synthesized in the cytoplasm, to be exported to the lumen of the Golgi apparatus or the endoplasmic reticulum where it is used for the synthesis of glycoproteins and glycolipids.


Pssm-ID: 129885  Cd Length: 222  Bit Score: 172.54  E-value: 3.94e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293    90 KVCVPSLVYIVQNNLLYVSASHLDAATYQVTyQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSG 169
Cdd:TIGR00803   1 KLSVPIHIIFKQNNLVLIALGNLLAAGKQVT-QLKILSTALMTLGSLVASLGDDQWFSLKLLKLGVAIVQMVQSSAKTLM 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   170 saggaaaaataassggapEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSR 249
Cdd:TIGR00803  80 ------------------FGNPVVGLSAVLSALLSSGFAGVYFEKILKDGDTMFWSRNLQLPLFGLFSTFSVLLWSDGTL 141
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   250 IFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFL 329
Cdd:TIGR00803 142 ISNFGFFIGYPTAVWIVGLLNVGGGLCIGGVVRYADNTTKSFVTALSIILSTLASVRLFDAKISSTFYLGAILVFLATFL 221

                  .
gi 18543293   330 Y 330
Cdd:TIGR00803 222 Y 222
 
Name Accession Description Interval E-value
Nuc_sug_transp pfam04142
Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars ...
7-331 8.94e-164

Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars from the cytoplasm into Golgi vesicles. SSLC35A1 transports CMP-sialic acid, SLC35A2 transports UDP-galactose and SLC35A3 transports UDP-GlcNAc.


Pssm-ID: 282054  Cd Length: 315  Bit Score: 464.51  E-value: 8.94e-164
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293     7 NANTLKYISLLTLTLQNAILGLSMRYARTR-PGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP 85
Cdd:pfam04142   1 NSSTFKYISLAVLTVQNASLVLTLRYSRTRkDGPRYFSTTAVLMAEIIKLVVCFLLLYKETKSDARKFLRELHKEIFNSP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293    86 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEG 165
Cdd:pfam04142  81 RDTLKVAVPSLIYTLQNNLLYVALSNLDAATYQVTYQLKILTTAIFSVLMLGRKLSTLQWMSLFLLMAGVALVQYQQASS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   166 PTSGSAGGAAaaataassggaPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVN 245
Cdd:pfam04142 161 PESESAAAAA-----------VEQNPILGLSAVLAACFSSGFAGVYFEKILKGSNVSLWIRNIQLALFGIIFALLGAWLY 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   246 DGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIA 325
Cdd:pfam04142 230 DGSRISEKGFFFGYTDVVWIVVLLQAVGGLVIAVVVKYADNILKGFATSLSIILSTVASVLLFDFFITLTFLLGAILVIA 309

                  ....*.
gi 18543293   326 SIFLYG 331
Cdd:pfam04142 310 AIFLYG 315
nst TIGR00803
UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10) ...
90-330 3.94e-51

UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10)Nucleotide-sugar transporters (NSTs) are found in the Golgi apparatus and the endoplasmic reticulum of eukaryotic cells. Members of the family have been sequenced from yeast, protozoans and animals. Animals such as C. elegans possess many of these transporters. Humans have at least two closely related isoforms of the UDP-galactose:UMP exchange transporter.NSTs generally appear to function by antiport mechanisms, exchanging a nucleotide-sugar for a nucleotide. Thus, CMP-sialic acid is exchanged for CMP; GDP-mannose is preferentially exchanged for GMP, and UDP-galactose and UDP-N-acetylglucosamine are exchanged for UMP (or possibly UDP). Other nucleotide sugars (e.g., GDP-fucose, UDP-xylose, UDP-glucose, UDP-N-acetylgalactosamine, etc.) may also be transported in exchange for various nucleotides, but their transporters have not been molecularly characterized. Each compound appears to be translocated by its own transport protein. Transport allows the compound, synthesized in the cytoplasm, to be exported to the lumen of the Golgi apparatus or the endoplasmic reticulum where it is used for the synthesis of glycoproteins and glycolipids.


Pssm-ID: 129885  Cd Length: 222  Bit Score: 172.54  E-value: 3.94e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293    90 KVCVPSLVYIVQNNLLYVSASHLDAATYQVTyQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSG 169
Cdd:TIGR00803   1 KLSVPIHIIFKQNNLVLIALGNLLAAGKQVT-QLKILSTALMTLGSLVASLGDDQWFSLKLLKLGVAIVQMVQSSAKTLM 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   170 saggaaaaataassggapEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSR 249
Cdd:TIGR00803  80 ------------------FGNPVVGLSAVLSALLSSGFAGVYFEKILKDGDTMFWSRNLQLPLFGLFSTFSVLLWSDGTL 141
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18543293   250 IFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFL 329
Cdd:TIGR00803 142 ISNFGFFIGYPTAVWIVGLLNVGGGLCIGGVVRYADNTTKSFVTALSIILSTLASVRLFDAKISSTFYLGAILVFLATFL 221

                  .
gi 18543293   330 Y 330
Cdd:TIGR00803 222 Y 222
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH