NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|18419845|ref|NP_568005|]
View 

long-chain base1 [Arabidopsis thaliana]

Protein Classification

PLN02822 family protein (domain architecture ID 10010912)

PLN02822 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PLN02822 PLN02822
serine palmitoyltransferase
1-481 0e+00

serine palmitoyltransferase


:

Pssm-ID: 178417  Cd Length: 481  Bit Score: 941.09  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845    1 MASNLVEMFNAALNWVTMILESPSARVVLFGVPIRGHFFVEGLLGVVIIILLTRKSYKPPKRPLTEQEIDELCDEWVPEP 80
Cdd:PLN02822   1 MALNVLNLVNAALERVTMLLEAPLARAVVFGVHIGGHLVVEGLLIVVIVFLLSQKSYKPPKRPLTEKEIDELCDEWTPEP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   81 LIPPITEDMKHEPPVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCE 160
Cdd:PLN02822  81 LIPPITEEMRPEPPVLESAAGPHTIINGKDVVNFASANYLGLIGNEKIKESCTSALEKYGVGSCGPRGFYGTIDVHLDCE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  161 TRISKFLGTPDSILYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYK 240
Cdd:PLN02822 161 TKIAKFLGTPDSILYSYGLSTIFSVIPAFCKKGDIIVADEGVHWGIQNGLYLSRSTIVYFKHNDMESLRNTLEKLTAENK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  241 RSKNLRRYIVAEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALAT 320
Cdd:PLN02822 241 RKKKLRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVLLDESNSFGVLGKSGRGLSEHFGVPIEKIDIITAAMGHALAT 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  321 EGGFCTGNARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIKGMSLTSNRESPI 400
Cdd:PLN02822 321 EGGFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEDNPSVLAKLKENIALLHKGLSDIPGLSIGSNTLSPI 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  401 VFLKLEKSSGSAKDDLLLLEKMADRALKEDSLLVVSSKRSFLDKCRLPVGIKLYVSAGHSESDLLKASESLKRLASELLL 480
Cdd:PLN02822 401 VFLHLEKSTGSAKEDLSLLEHIADRMLKEDSVLVVVSKRSTLDKCRLPVGIRLFVSAGHTESDILKASESLKRVAASVLK 480

                 .
gi 18419845  481 K 481
Cdd:PLN02822 481 K 481
 
Name Accession Description Interval E-value
PLN02822 PLN02822
serine palmitoyltransferase
1-481 0e+00

serine palmitoyltransferase


Pssm-ID: 178417  Cd Length: 481  Bit Score: 941.09  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845    1 MASNLVEMFNAALNWVTMILESPSARVVLFGVPIRGHFFVEGLLGVVIIILLTRKSYKPPKRPLTEQEIDELCDEWVPEP 80
Cdd:PLN02822   1 MALNVLNLVNAALERVTMLLEAPLARAVVFGVHIGGHLVVEGLLIVVIVFLLSQKSYKPPKRPLTEKEIDELCDEWTPEP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   81 LIPPITEDMKHEPPVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCE 160
Cdd:PLN02822  81 LIPPITEEMRPEPPVLESAAGPHTIINGKDVVNFASANYLGLIGNEKIKESCTSALEKYGVGSCGPRGFYGTIDVHLDCE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  161 TRISKFLGTPDSILYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYK 240
Cdd:PLN02822 161 TKIAKFLGTPDSILYSYGLSTIFSVIPAFCKKGDIIVADEGVHWGIQNGLYLSRSTIVYFKHNDMESLRNTLEKLTAENK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  241 RSKNLRRYIVAEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALAT 320
Cdd:PLN02822 241 RKKKLRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVLLDESNSFGVLGKSGRGLSEHFGVPIEKIDIITAAMGHALAT 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  321 EGGFCTGNARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIKGMSLTSNRESPI 400
Cdd:PLN02822 321 EGGFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEDNPSVLAKLKENIALLHKGLSDIPGLSIGSNTLSPI 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  401 VFLKLEKSSGSAKDDLLLLEKMADRALKEDSLLVVSSKRSFLDKCRLPVGIKLYVSAGHSESDLLKASESLKRLASELLL 480
Cdd:PLN02822 401 VFLHLEKSTGSAKEDLSLLEHIADRMLKEDSVLVVVSKRSTLDKCRLPVGIRLFVSAGHTESDILKASESLKRVAASVLK 480

                 .
gi 18419845  481 K 481
Cdd:PLN02822 481 K 481
BioF COG0156
7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism];
94-403 1.22e-95

7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism];


Pssm-ID: 223234  Cd Length: 388  Bit Score: 297.63  E-value: 1.22e-95
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  94 PVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSI 173
Cdd:COG0156  24 RALDRRQGLAIRADGRKVLNFCSNDYLGLASHPELIEAAKAAIRRYGVGAGGSRLISGTSDLHVELEEELADFLGAEAAL 103
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 174 LYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLritlEKIMTKYKRSKNLRRYIVAEA 253
Cdd:COG0156 104 LFSSGFVANLGLLSALLKKGDLIFSDELNHASIIDGIRLSRAEVRRFKHNDLDHL----EALLEEARENGARRKLIVTEG 179
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 254 VYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALATEGGFCTGNARIID 333
Cdd:COG0156 180 VFSMDGDIAPLPELVELAEKYGALLYVDEAHAVGVLGPNGRGLAEHFGLEPEEVDIIVGTLGKALGSSGGYIAGSAALID 259
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 334 YQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLwKGLSDIKGMSLTSNrESPIVFL 403
Cdd:COG0156 260 YLRNRARPFIFSTALPPAVAAAALAALRILEEGPERRERLQELAAFF-RSLLKALGLVLLPS-ESPIIPV 327
KBL_like cd06454
KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate ...
109-474 2.21e-80

KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.


Pssm-ID: 99747  Cd Length: 349  Bit Score: 256.72  E-value: 2.21e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 109 KDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSILYSYGLSTMFSTIPC 188
Cdd:cd06454   1 KKVLNFCSNDYLGLANHPEVIEAAKEALDKYGVGAGGSRLISGTSDLHEELEEELAEFHGKEAALVFSSGYAANDGVLST 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 189 FCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKrsknlRRYIVAEAVYQNSGQIAPLDEIV 268
Cdd:cd06454  81 LAGKGDLIISDSLNHASIIDGIRLSGAKKRIFKHNDMEDLEKLLREARRPYG-----KKLIVTEGVYSMDGDIAPLPELV 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 269 KLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPiEKIDVVTAAMGHALATEGGFCTGNARIIDYQRLSSSGYVFSASL 348
Cdd:cd06454 156 DLAKKYGAILFVDEAHSVGVYGPHGRGVEEFGGLT-DDVDIIMGTLGKAFGAVGGYIAGSKELIDYLRSYARGFIFSTSL 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 349 PPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkGMSLTSNRESPIVFLKLEKSSgsakddlllLEKMADRALK 428
Cdd:cd06454 235 PPAVAAAALAALEVLQGGPERRERLQENVRYLRRGLKEL-GFPVGGSPSHIIPPLIGDDPA---------KAVAFSDALL 304
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 18419845 429 EDSLLVVSskrsfldkCRLPVG------IKLYVSAGHSESDLLKASESLKRL 474
Cdd:cd06454 305 ERGIYVQA--------IRYPTVprgtarLRISLSAAHTKEDIDRLLEALKEV 348
gly_Cac_T_rel TIGR01825
pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme ...
92-478 1.04e-67

pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme subfamily related to three known enzymes; it appears closest to glycine C-acteyltransferase, shows no overlap with it in species distribution, and may share that function. The three closely related enzymes are glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase), 5-aminolevulinic acid synthase, and 8-amino-7-oxononanoate synthase. All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.


Pssm-ID: 130884  Cd Length: 385  Bit Score: 224.70  E-value: 1.04e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845    92 EPPVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPD 171
Cdd:TIGR01825  16 SIRVLESAQGPRVRVNGKEVINLSSNNYLGFADHPRLKEAAAQAIQQYGVGAGAVRTIAGTLRLHEELEEKLAKFKKTEA 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   172 SILYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKrsknlrRYIVA 251
Cdd:TIGR01825  96 ALVFQSGFNTNQGVLSALLRKGDIVLSDELNHASIIDGLRLTKATKKIYKHADMDDLDRVLRENPSYGK------KLIVT 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   252 EAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPiEKIDVVTAAMGHALATEGGFCTGNARI 331
Cdd:TIGR01825 170 DGVFSMDGDVAPLPEIVELAERYGAVTYVDDAHGSGVMGEAGRGTVHHFGLE-DKVDIQVGTLSKAIGVVGGYAAGHKEL 248
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   332 IDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkGMSLTsNRESPI--VFLKLEKSS 409
Cdd:TIGR01825 249 IEYLKNRARPFLFSTAQPPAVVAALAAAVDELQRSPELMERLWDNTRFFKAGLGKL-GYDTG-GSETPItpVVIGDEKAA 326
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18419845   410 GSAKDDLLllekmaDRALKEDSLLVVSSKRsflDKCRlpvgIKLYVSAGHSESDLLKASESLKRLASEL 478
Cdd:TIGR01825 327 QEFSRRLF------DEGIFAQSIVFPTVPR---GTAR----IRNIPTAEHTKDDLDQALDAYEKVGKEL 382
Aminotran_1_2 pfam00155
Aminotransferase class I and II;
109-471 1.72e-28

Aminotransferase class I and II;


Pssm-ID: 306629  Cd Length: 351  Bit Score: 115.48  E-value: 1.72e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   109 KDVVNFASANYLGLighekLLESCTSALEKygVGSCGPRGFYGTIDVHLDCETRISKFLGTP--------DSILYSYGLS 180
Cdd:pfam00155   1 TDKINLGSNEYLGD-----TLPAVAKAEKD--ALAGGTRNLYGPTDGHPELREALAKFLGRSpvlkldreAAVVFGSGAG 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   181 TMFSTIP-CFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKrskNLRRYIVAEAVYQNSG 259
Cdd:pfam00155  74 ANIEALIfLLANPGDAILVPAPTYASYIRIARLAGGEVVRYPLYDSNDFHLDFDALEAALK---EKPKVVLHTSPHNPTG 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   260 QIAPLDEIVKL---KEKYRFRVILDESNSFGVLGRSGR-----GLAEHHSVpiekidVVTAAMGHALATEG---GFCTGN 328
Cdd:pfam00155 151 TVATLEELEKLldlAKEHNILLLVDEAYAGFVFGSPDAvatraLLAEGPNL------LVVGSFSKAFGLAGwrvGYILGN 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   329 ARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkGMSLTSNrESPIVFLklekS 408
Cdd:pfam00155 225 AAVISQLRKLARPFYSSTHLQAAAAAALSDPLLVASELEEMRQRIKERRDYLRDGLQAA-GLSVLPS-QAGFFLL----T 298
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 18419845   409 SGSAKDDLLLLEKMADRAlkedsLLVVSSKRSFLDKCRLPVGIklyvsAGHSESDLLKASESL 471
Cdd:pfam00155 299 GLDPETAKELAQVLLEEV-----GVYVTPGSSPGVPGWLRITV-----AGGTEEELEELLEAI 351
 
Name Accession Description Interval E-value
PLN02822 PLN02822
serine palmitoyltransferase
1-481 0e+00

serine palmitoyltransferase


Pssm-ID: 178417  Cd Length: 481  Bit Score: 941.09  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845    1 MASNLVEMFNAALNWVTMILESPSARVVLFGVPIRGHFFVEGLLGVVIIILLTRKSYKPPKRPLTEQEIDELCDEWVPEP 80
Cdd:PLN02822   1 MALNVLNLVNAALERVTMLLEAPLARAVVFGVHIGGHLVVEGLLIVVIVFLLSQKSYKPPKRPLTEKEIDELCDEWTPEP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   81 LIPPITEDMKHEPPVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCE 160
Cdd:PLN02822  81 LIPPITEEMRPEPPVLESAAGPHTIINGKDVVNFASANYLGLIGNEKIKESCTSALEKYGVGSCGPRGFYGTIDVHLDCE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  161 TRISKFLGTPDSILYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYK 240
Cdd:PLN02822 161 TKIAKFLGTPDSILYSYGLSTIFSVIPAFCKKGDIIVADEGVHWGIQNGLYLSRSTIVYFKHNDMESLRNTLEKLTAENK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  241 RSKNLRRYIVAEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALAT 320
Cdd:PLN02822 241 RKKKLRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVLLDESNSFGVLGKSGRGLSEHFGVPIEKIDIITAAMGHALAT 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  321 EGGFCTGNARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIKGMSLTSNRESPI 400
Cdd:PLN02822 321 EGGFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEDNPSVLAKLKENIALLHKGLSDIPGLSIGSNTLSPI 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  401 VFLKLEKSSGSAKDDLLLLEKMADRALKEDSLLVVSSKRSFLDKCRLPVGIKLYVSAGHSESDLLKASESLKRLASELLL 480
Cdd:PLN02822 401 VFLHLEKSTGSAKEDLSLLEHIADRMLKEDSVLVVVSKRSTLDKCRLPVGIRLFVSAGHTESDILKASESLKRVAASVLK 480

                 .
gi 18419845  481 K 481
Cdd:PLN02822 481 K 481
PLN03227 PLN03227
serine palmitoyltransferase-like protein; Provisional
112-481 9.91e-112

serine palmitoyltransferase-like protein; Provisional


Pssm-ID: 178766  Cd Length: 392  Bit Score: 339.57  E-value: 9.91e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  112 VNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSILYSYGLSTMFSTIPCFCK 191
Cdd:PLN03227   1 LNFATHDFLSTSSSPTLRQTALESLSHYGCGSCGPRGFYGTIDAHLELEQCMAEFLGTESAILYSDGASTTSSTVAAFAK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  192 KGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTK---YKRSKNL-RRYIVAEAVYQNSGQIAPLDEI 267
Cdd:PLN03227  81 RGDLLVVDRGVNEALLVGVSLSRANVRWFRHNDMKDLRRVLEQVRAQdvaLKRKPTDqRRFLVVEGLYKNTGTLAPLKEL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  268 VKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSV-PIEKIDVVTAAMGHALATEGGFCTGNARIIDYQRLSSSGYVFSA 346
Cdd:PLN03227 161 VALKEEFHYRLILDESFSFGTLGKSGRGSLEHAGLkPMVHAEIVTFSLENAFGSVGGMTVGSEEVVDHQRLSGSGYCFSA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  347 SLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGL--SDI-------KGMSLTSNRESPIVFLKLEKSSGSAK-DDL 416
Cdd:PLN03227 241 SAPPFLAKADATATAGELAGPQLLNRLHDSIANLYSTLtnSSHpyalklrNRLVITSDPISPIIYLRLSDQEATRRtDET 320
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 18419845  417 LLLEKMADRALKEdSLLVVSSKRSF--LDKCRLPVGIKLYVSAGHSESDLLKASESLKRLASELLLK 481
Cdd:PLN03227 321 LILDQIAHHSLSE-GVAVVSTGGHVkkFLQLVPPPCLRVVANASHTREDIDKLLTVLGEAVEAILCK 386
BioF COG0156
7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism];
94-403 1.22e-95

7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism];


Pssm-ID: 223234  Cd Length: 388  Bit Score: 297.63  E-value: 1.22e-95
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  94 PVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSI 173
Cdd:COG0156  24 RALDRRQGLAIRADGRKVLNFCSNDYLGLASHPELIEAAKAAIRRYGVGAGGSRLISGTSDLHVELEEELADFLGAEAAL 103
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 174 LYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLritlEKIMTKYKRSKNLRRYIVAEA 253
Cdd:COG0156 104 LFSSGFVANLGLLSALLKKGDLIFSDELNHASIIDGIRLSRAEVRRFKHNDLDHL----EALLEEARENGARRKLIVTEG 179
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 254 VYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALATEGGFCTGNARIID 333
Cdd:COG0156 180 VFSMDGDIAPLPELVELAEKYGALLYVDEAHAVGVLGPNGRGLAEHFGLEPEEVDIIVGTLGKALGSSGGYIAGSAALID 259
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 334 YQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLwKGLSDIKGMSLTSNrESPIVFL 403
Cdd:COG0156 260 YLRNRARPFIFSTALPPAVAAAALAALRILEEGPERRERLQELAAFF-RSLLKALGLVLLPS-ESPIIPV 327
KBL_like cd06454
KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate ...
109-474 2.21e-80

KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.


Pssm-ID: 99747  Cd Length: 349  Bit Score: 256.72  E-value: 2.21e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 109 KDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSILYSYGLSTMFSTIPC 188
Cdd:cd06454   1 KKVLNFCSNDYLGLANHPEVIEAAKEALDKYGVGAGGSRLISGTSDLHEELEEELAEFHGKEAALVFSSGYAANDGVLST 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 189 FCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKrsknlRRYIVAEAVYQNSGQIAPLDEIV 268
Cdd:cd06454  81 LAGKGDLIISDSLNHASIIDGIRLSGAKKRIFKHNDMEDLEKLLREARRPYG-----KKLIVTEGVYSMDGDIAPLPELV 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 269 KLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPiEKIDVVTAAMGHALATEGGFCTGNARIIDYQRLSSSGYVFSASL 348
Cdd:cd06454 156 DLAKKYGAILFVDEAHSVGVYGPHGRGVEEFGGLT-DDVDIIMGTLGKAFGAVGGYIAGSKELIDYLRSYARGFIFSTSL 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 349 PPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkGMSLTSNRESPIVFLKLEKSSgsakddlllLEKMADRALK 428
Cdd:cd06454 235 PPAVAAAALAALEVLQGGPERRERLQENVRYLRRGLKEL-GFPVGGSPSHIIPPLIGDDPA---------KAVAFSDALL 304
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 18419845 429 EDSLLVVSskrsfldkCRLPVG------IKLYVSAGHSESDLLKASESLKRL 474
Cdd:cd06454 305 ERGIYVQA--------IRYPTVprgtarLRISLSAAHTKEDIDRLLEALKEV 348
PRK06939 PRK06939
2-amino-3-ketobutyrate coenzyme A ligase; Provisional
95-478 2.69e-70

2-amino-3-ketobutyrate coenzyme A ligase; Provisional


Pssm-ID: 235893  Cd Length: 397  Bit Score: 232.01  E-value: 2.69e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   95 VLESAAGPHTTV-NGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSI 173
Cdd:PRK06939  27 VITSPQGADITVaDGKEVINFCANNYLGLANHPELIAAAKAALDSHGFGMASVRFICGTQDLHKELEEKLAKFLGTEDAI 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  174 LYSYGLST---MFSTIpcfCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKRsknlRRYIV 250
Cdd:PRK06939 107 LYSSCFDAnggLFETL---LGKEDAIISDALNHASIIDGVRLCKAKRYRYANNDMADLEAQLKEAKEAGAR----HKLIA 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  251 AEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVpIEKIDVVTAAMGHALA-TEGGFCTGNA 329
Cdd:PRK06939 180 TDGVFSMDGDIAPLPEICDLADKYDALVMVDDSHAVGFVGENGRGTVEHFGV-MDRVDIITGTLGKALGgASGGYTAGRK 258
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  330 RIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkGMSLTsNRESPIVFLKLekss 409
Cdd:PRK06939 259 EVIDWLRQRSRPYLFSNSLAPAIVAASIKVLELLEESDELRDRLWENARYFREGMTAA-GFTLG-PGEHPIIPVML---- 332
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18419845  410 GSAKddllLLEKMADRALKED------SLLVVSskrsfLDKCRlpvgIKLYVSAGHSESDLLKASESLKRLASEL 478
Cdd:PRK06939 333 GDAK----LAQEFADRLLEEGvyvigfSFPVVP-----KGQAR----IRTQMSAAHTKEQLDRAIDAFEKVGKEL 394
gly_Cac_T_rel TIGR01825
pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme ...
92-478 1.04e-67

pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme subfamily related to three known enzymes; it appears closest to glycine C-acteyltransferase, shows no overlap with it in species distribution, and may share that function. The three closely related enzymes are glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase), 5-aminolevulinic acid synthase, and 8-amino-7-oxononanoate synthase. All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.


Pssm-ID: 130884  Cd Length: 385  Bit Score: 224.70  E-value: 1.04e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845    92 EPPVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPD 171
Cdd:TIGR01825  16 SIRVLESAQGPRVRVNGKEVINLSSNNYLGFADHPRLKEAAAQAIQQYGVGAGAVRTIAGTLRLHEELEEKLAKFKKTEA 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   172 SILYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKrsknlrRYIVA 251
Cdd:TIGR01825  96 ALVFQSGFNTNQGVLSALLRKGDIVLSDELNHASIIDGLRLTKATKKIYKHADMDDLDRVLRENPSYGK------KLIVT 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   252 EAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPiEKIDVVTAAMGHALATEGGFCTGNARI 331
Cdd:TIGR01825 170 DGVFSMDGDVAPLPEIVELAERYGAVTYVDDAHGSGVMGEAGRGTVHHFGLE-DKVDIQVGTLSKAIGVVGGYAAGHKEL 248
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   332 IDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkGMSLTsNRESPI--VFLKLEKSS 409
Cdd:TIGR01825 249 IEYLKNRARPFLFSTAQPPAVVAALAAAVDELQRSPELMERLWDNTRFFKAGLGKL-GYDTG-GSETPItpVVIGDEKAA 326
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18419845   410 GSAKDDLLllekmaDRALKEDSLLVVSSKRsflDKCRlpvgIKLYVSAGHSESDLLKASESLKRLASEL 478
Cdd:TIGR01825 327 QEFSRRLF------DEGIFAQSIVFPTVPR---GTAR----IRNIPTAEHTKDDLDQALDAYEKVGKEL 382
bioF TIGR00858
8-amino-7-oxononanoate synthase; 7-keto-8-aminopelargonic acid synthetase is an alternate name. ...
94-472 1.03e-66

8-amino-7-oxononanoate synthase; 7-keto-8-aminopelargonic acid synthetase is an alternate name. This model represents 8-amino-7-oxononanoate synthase, the BioF protein of biotin biosynthesis. This model is based on a careful phylogenetic analysis to separate members of this family from 2-amino-3-ketobutyrate and other related pyridoxal phosphate-dependent enzymes. In several species, including Staphylococcus and Coxiella, a candidate 8-amino-7-oxononanoate synthase is confirmed by location in the midst of a biotin biosynthesis operon but scores below the trusted cutoff of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin]


Pssm-ID: 273303  Cd Length: 360  Bit Score: 221.37  E-value: 1.03e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845    94 PVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSI 173
Cdd:TIGR00858   1 RPLDRGPGPEVVRDGRRLLNFSSNDYLGLASHPEVIQAAQQGAEQYGAGSTASRLVSGNSPLHEELEEELAEWKGTEAAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   174 LYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEkimtkyKRSKNLRRYIVAEA 253
Cdd:TIGR00858  81 LFSSGYLANVGVISALVGKGDLILSDALNHASLIDGCRLSGARVRRYRHNDVEHLERLLE------KNRGERRKLIVTDG 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   254 VYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALATEGGFCTGNARIID 333
Cdd:TIGR00858 155 VFSMDGDIAPLPQLVALAERYGAWLMVDDAHGTGVLGEDGRGTLEHFGLKPEPVDIQVGTLSKALGSYGAYVAGSQALID 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   334 YQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIKGMSLTSnrESPIVFLKLekssGSAK 413
Cdd:TIGR00858 235 YLINRARTLIFSTALPPAVAAAALAALELIQEEPWRREKLLALIARLRAGLEALGFTLMPS--CTPIVPVII----GDNA 308
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18419845   414 DDLLLLEKmadraLKEDSLLVVSskrsfldkCR---LPVG---IKLYVSAGHSESDLLKASESLK 472
Cdd:TIGR00858 309 SALALAEE-----LQQQGIFVGA--------IRpptVPAGtsrLRLTLSAAHTPGDIDRLAEALK 360
PRK05958 PRK05958
8-amino-7-oxononanoate synthase; Reviewed
94-401 1.69e-61

8-amino-7-oxononanoate synthase; Reviewed


Pssm-ID: 235655  Cd Length: 385  Bit Score: 208.47  E-value: 1.69e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   94 PVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSI 173
Cdd:PRK05958  24 RPREGGAGRWLVVDGRRMLNFASNDYLGLARHPRLIAAAQQAARRYGAGSGGSRLVTGNSPAHEALEEELAEWFGAERAL 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  174 LYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKimtkykrSKNLRRYIVAEA 253
Cdd:PRK05958 104 LFSSGYAANLAVLTALAGKGDLIVSDKLNHASLIDGARLSRARVRRYPHNDVDALEALLAK-------WRAGRALIVTES 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  254 VYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALATEGGFCTGNARIID 333
Cdd:PRK05958 177 VFSMDGDLAPLAELVALARRHGAWLLVDEAHGTGVLGPQGRGLAAEAGLAGEPDVILVGTLGKALGSSGAAVLGSETLID 256
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 18419845  334 YQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIKGMSLTSnrESPIV 401
Cdd:PRK05958 257 YLINRARPFIFTTALPPAQAAAARAALRILRREPERRERLAALIARLRAGLRALGFQLMDS--QSAIQ 322
2am3keto_CoA TIGR01822
glycine C-acetyltransferase; This model represents a narrowly defined clade of animal and ...
95-478 5.27e-54

glycine C-acetyltransferase; This model represents a narrowly defined clade of animal and bacterial (almost exclusively Proteobacterial) 2-amino-3-ketobutyrate--CoA ligase, now called glycine C-acetyltransferase. This enzyme can act in threonine catabolism. The closest homolog from Bacillus subtilis, and sequences like it, may be functionally equivalent but were not included in the model because of difficulty in finding reports of function. [Energy metabolism, Amino acids and amines]


Pssm-ID: 130881  Cd Length: 393  Bit Score: 188.48  E-value: 5.27e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845    95 VLESAAGPHTTVN-GKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSI 173
Cdd:TIGR01822  23 IITSPQGADIRVAdGREVLNFCANNYLGLSSHPDLIQAAKDALDEHGFGMSSVRFICGTQDIHKELEAKIAAFLGTEDTI 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   174 LYSyglstmfstiPCFCKKG----------DVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKRSk 243
Cdd:TIGR01822 103 LYA----------SCFDANGglfetllgaeDAIISDALNHASIIDGVRLCKAKRYRYANNDMADLEAQLKEARAAGARH- 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   244 nlrRYIVAEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVpIEKIDVVTAAMGHAL-ATEG 322
Cdd:TIGR01822 172 ---RLIATDGVFSMDGVIAPLDEICDLADKYDALVMVDECHATGFLGPTGRGSHELCGV-MGRVDIITGTLGKALgGASG 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   323 GFCTGNARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLS----DIKGMsltsnrES 398
Cdd:TIGR01822 248 GFTTARKEVVELLRQRSRPYLFSNSLPPAVVGASIKVLEMLEASNELRDRLWANTRYFRERMEaagfDIKPA------DH 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   399 PIVFLKLekssGSAKddllLLEKMADRALKEdSLLVVSSKRSFLDKCRlpVGIKLYVSAGHSESDLLKASESLKRLASEL 478
Cdd:TIGR01822 322 PIIPVML----YDAV----LAQRFARRLLEE-GIYVTGFFYPVVPKGQ--ARIRVQISAAHTEEQLDRAVEAFTRIGREL 390
PLN02483 PLN02483
serine palmitoyltransferase
103-481 6.98e-49

serine palmitoyltransferase


Pssm-ID: 178101  Cd Length: 489  Bit Score: 176.88  E-value: 6.98e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  103 HTTVNGKDVVNFASANYLGLIGHEkllESCT----SALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSILYSYG 178
Cdd:PLN02483  94 KRTTKTRRCLNLGSYNYLGFAAAD---EYCTprviESLKKYSASTCSSRVDGGTTKLHRELEELVARFVGKPAAIVFGMG 170
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  179 LSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITL-EKIMTKYKRS-KNLRRYIV-AEAVY 255
Cdd:PLN02483 171 YATNSTIIPALIGKGGLIISDSLNHNSIVNGARGSGATIRVFQHNTPSHLEEVLrEQIAEGQPRThRPWKKIIViVEGIY 250
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  256 QNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEKIDVVTAAMGHALATEGGFCTGNARIIDYQ 335
Cdd:PLN02483 251 SMEGELCKLPEIVAVCKKYKAYVYLDEAHSIGAVGKTGRGVCELLGVDPADVDIMMGTFTKSFGSCGGYIAGSKELIQYL 330
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  336 RLSSSGYVFSASLPPYLASAAITAIDVI------DQNPDMLVKLKQNVALLWKGLSDIkGMSLTSNRESPIVFLKLEKSS 409
Cdd:PLN02483 331 KRTCPAHLYATSMSPPAVQQVISAIKVIlgedgtNRGAQKLAQIRENSNFFRSELQKM-GFEVLGDNDSPVMPIMLYNPA 409
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 18419845  410 gsakddlllleKMAD---RALKED-SLLVVSSKRSFLDKCRLPVGIklyvSAGHSESDLLKASESLKRLASELLLK 481
Cdd:PLN02483 410 -----------KIPAfsrECLKQNvAVVVVGFPATPLLLARARICI----SASHSREDLIKALEVISEVGDLVGIK 470
PRK09064 PRK09064
5-aminolevulinate synthase; Validated
96-386 4.30e-41

5-aminolevulinate synthase; Validated


Pssm-ID: 236370  Cd Length: 407  Bit Score: 153.47  E-value: 4.30e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   96 LESAAG--PHTTVN-----GKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLG 168
Cdd:PRK09064  26 LERIAGrfPYATWRrpdggEREVTVWCSNDYLGMGQHPKVIEAMIEALDRCGAGAGGTRNISGTNHYHVELERELADLHG 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  169 TPDSILYSYG-------LSTMFSTIPcfckkGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKImtkykr 241
Cdd:PRK09064 106 KEAALVFTSGyvsndatLSTLAKLIP-----DCVIFSDELNHASMIEGIRRSRCEKHIFRHNDVAHLEELLAAA------ 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  242 SKNLRRYIVAEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVpIEKIDVVTAAMGHALATE 321
Cdd:PRK09064 175 DPDRPKLIAFESVYSMDGDIAPIAEICDLADKYNALTYLDEVHAVGMYGPRGGGIAERDGL-MDRIDIIEGTLAKAFGVM 253
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18419845  322 GGFCTGNARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSD 386
Cdd:PRK09064 254 GGYIAGSAALVDAVRSYAPGFIFTTSLPPAIAAAALASIRHLKESNEERERHQERAAKLKAALDA 318
5aminolev_synth TIGR01821
5-aminolevulinic acid synthase; This model represents 5-aminolevulinic acid synthase, an ...
103-401 1.55e-40

5-aminolevulinic acid synthase; This model represents 5-aminolevulinic acid synthase, an enzyme for one of two routes to the heme precursor 5-aminolevulinate. The protein is a pyridoxal phosphate-dependent enzyme related to 2-amino-3-ketobutyrate CoA tranferase and 8-amino-7-oxononanoate synthase. This enzyme appears restricted to the alpha Proteobacteria and mitochondrial derivatives. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]


Pssm-ID: 273820  Cd Length: 402  Bit Score: 151.80  E-value: 1.55e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   103 HTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSILYSYGLSTM 182
Cdd:TIGR01821  39 HRPDGAKDVTVWCSNDYLGMGQHPEVLQAMHETLDKYGAGAGGTRNISGTNIPHVELEAELADLHGKESALVFTSGYVAN 118
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   183 FSTIPCFCKK--GDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKImtkykrSKNLRRYIVAEAVYQNSGQ 260
Cdd:TIGR01821 119 DATLATLAKIipGCVIFSDELNHASMIEGIRHSGAEKFIFRHNDVAHLEKLLQSV------DPNRPKIIAFESVYSMDGD 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   261 IAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVpIEKIDVVTAAMGHALATEGGFCTGNARIIDYQRLSSS 340
Cdd:TIGR01821 193 IAPIEEICDLADKYGALTYLDEVHAVGLYGPRGGGIAERDGL-MHRIDIIEGTLAKAFGVVGGYIAASRKLIDAIRSYAP 271
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 18419845   341 GYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLwKGLSDIKGMSLTSNrESPIV 401
Cdd:TIGR01821 272 GFIFTTSLPPAIAAGATASIRHLKESQDLRRAHQENVKRL-KNLLEALGIPVIPN-PSHIV 330
PRK13393 PRK13393
5-aminolevulinate synthase; Provisional
96-401 1.12e-38

5-aminolevulinate synthase; Provisional


Pssm-ID: 184024  Cd Length: 406  Bit Score: 146.39  E-value: 1.12e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   96 LESAAG--PHTTVNGKD----VVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGT 169
Cdd:PRK13393  26 LERQAGafPRATHHGPDgpreVTVWCSNDYLGMGQHPAVLAAMHEALDTCGAGAGGTRNISGTNHYHVLLEAELADLHGK 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  170 PDSILYSYG-------LSTMFSTIPcfckkGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLritlEKIMTKYKRS 242
Cdd:PRK13393 106 EAALLFTSGyvsnwaaLSTLGSRLP-----GCVILSDELNHASMIEGIRHSRAEKRIFRHNDPADL----ERKLSDLDPH 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  243 knlRRYIVA-EAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVpIEKIDVVTAAMGHALATE 321
Cdd:PRK13393 177 ---RPKLVAfESVYSMDGDIAPIAEICDVAEKHGAMTYLDEVHAVGLYGPRGGGIAEREGL-ADRLTIIEGTLAKAFGVM 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  322 GGFCTGNARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLwKGLSDIKGMSLTSNrESPIV 401
Cdd:PRK13393 253 GGYITGSAALCDFIRSFASGFIFTTSLPPAVAAGALASVRHLKASSAERERHQDRVARL-RARLDKAGIPHLPN-PSHIV 330
PRK13392 PRK13392
5-aminolevulinate synthase; Provisional
97-360 1.44e-32

5-aminolevulinate synthase; Provisional


Pssm-ID: 184023  Cd Length: 410  Bit Score: 128.43  E-value: 1.44e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   97 ESAAGPHTTVNG----KDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDS 172
Cdd:PRK13392  30 EAGRFPRARDHGpdgpRRVTIWCSNDYLGMGQHPDVIGAMVDALDRYGAGAGGTRNISGTSHPHVLLERELADLHGKESA 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  173 ILYSYG-------LSTMFSTIPcfckkGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKykRSKnl 245
Cdd:PRK13392 110 LLFTSGyvsndaaLSTLGKLLP-----GCVILSDALNHASMIEGIRRSGAEKQVFRHNDLADLEEQLASVDPD--RPK-- 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  246 rrYIVAEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVpIEKIDVVTAAMGHALATEGGFC 325
Cdd:PRK13392 181 --LIAFESVYSMDGDIAPIEAICDLADRYNALTYVDEVHAVGLYGARGGGIAERDGL-MDRIDMIQGTLAKAFGCLGGYI 257
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 18419845  326 TGNARIIDYQRLSSSGYVFSASLPPYLASAAITAI 360
Cdd:PRK13392 258 AASADLIDFVRSFAPGFIFTTALPPAVAAGATAAI 292
Aminotran_1_2 pfam00155
Aminotransferase class I and II;
109-471 1.72e-28

Aminotransferase class I and II;


Pssm-ID: 306629  Cd Length: 351  Bit Score: 115.48  E-value: 1.72e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   109 KDVVNFASANYLGLighekLLESCTSALEKygVGSCGPRGFYGTIDVHLDCETRISKFLGTP--------DSILYSYGLS 180
Cdd:pfam00155   1 TDKINLGSNEYLGD-----TLPAVAKAEKD--ALAGGTRNLYGPTDGHPELREALAKFLGRSpvlkldreAAVVFGSGAG 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   181 TMFSTIP-CFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEKIMTKYKrskNLRRYIVAEAVYQNSG 259
Cdd:pfam00155  74 ANIEALIfLLANPGDAILVPAPTYASYIRIARLAGGEVVRYPLYDSNDFHLDFDALEAALK---EKPKVVLHTSPHNPTG 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   260 QIAPLDEIVKL---KEKYRFRVILDESNSFGVLGRSGR-----GLAEHHSVpiekidVVTAAMGHALATEG---GFCTGN 328
Cdd:pfam00155 151 TVATLEELEKLldlAKEHNILLLVDEAYAGFVFGSPDAvatraLLAEGPNL------LVVGSFSKAFGLAGwrvGYILGN 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   329 ARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkGMSLTSNrESPIVFLklekS 408
Cdd:pfam00155 225 AAVISQLRKLARPFYSSTHLQAAAAAALSDPLLVASELEEMRQRIKERRDYLRDGLQAA-GLSVLPS-QAGFFLL----T 298
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 18419845   409 SGSAKDDLLLLEKMADRAlkedsLLVVSSKRSFLDKCRLPVGIklyvsAGHSESDLLKASESL 471
Cdd:pfam00155 299 GLDPETAKELAQVLLEEV-----GVYVTPGSSPGVPGWLRITV-----AGGTEEELEELLEAI 351
PRK07179 PRK07179
hypothetical protein; Provisional
80-425 4.90e-27

hypothetical protein; Provisional


Pssm-ID: 180866  Cd Length: 407  Bit Score: 112.02  E-value: 4.90e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   80 PLIPPITEDMKH--EPPVLESAAGPHTtVNGK----DVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTI 153
Cdd:PRK07179  20 PLPDFIEERLDKyiEERVNKNWNGKHL-VLGKtpgpDAIILQSNDYLNLSGHPDIIKAQIAALQEEGDSLVMSAVFLHDD 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  154 DVHLDCETRISKFLGTPDSILYSYGLSTMFSTIPCFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRitle 233
Cdd:PRK07179  99 SPKPQFEKKLAAFTGFESCLLCQSGWAANVGLLQTIADPNTPVYIDFFAHMSLWEGVRAAGAQAHPFRHNDVDHLR---- 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  234 kimtkykrsKNLRRY----IVAEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVpIEKIDV 309
Cdd:PRK07179 175 ---------RQIERHgpgiIVVDSVYSTTGTIAPLADIVDIAEEFGCVLVVDESHSLGTHGPQGAGLVAELGL-TSRVHF 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  310 VTAAMGHALATEGGFCTGNARIIDYQRLSSSGYVFSASLPPYLASAAITAIDVIDQNPDMLVKLKQNVALLWKGLSDIkG 389
Cdd:PRK07179 245 ITASLAKAFAGRAGIITCPRELAEYVPFVSYPAIFSSTLLPHEIAGLEATLEVIESADDRRARLHANARFLREGLSEL-G 323
                        330       340       350
                 ....*....|....*....|....*....|....*.
gi 18419845  390 MSLTSnrESPIVFLKleksSGSAKDDLLLLEKMADR 425
Cdd:PRK07179 324 YNIRS--ESQIIALE----TGSERNTEVLRDALEER 353
PRK05937 PRK05937
8-amino-7-oxononanoate synthase; Provisional
108-361 8.06e-19

8-amino-7-oxononanoate synthase; Provisional


Pssm-ID: 102071  Cd Length: 370  Bit Score: 87.91  E-value: 8.06e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  108 GKDVVNFASANYLGLIGHEKLLESCTSALEKY-------GVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSILYSYGLs 180
Cdd:PRK05937   3 SSLSIDFVTNDFLGFSRSTTLVHEVEKRYRLYceqfphaQLGYGGSRAILGPSSLLDDLEHKIAHFHGAPEAFIVPSGY- 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  181 tMFSTIPCF--CKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLritlEKIMTKYKRSKNLRRYIVAEAVYQNS 258
Cdd:PRK05937  82 -MANLGLCAhlSSVTDYVLWDEQVHISVVYSLSVISGKHQSFRHNDLDHL----ESLLESCRAVSFGRIFIFVCSVYSFK 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  259 GQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAehHSVPIEKIDVVTAAMGHALATEGGfctgnARIIDYQR-- 336
Cdd:PRK05937 157 GTLAPLEQIIALSKKYHAHLIVDEAHAMGIFGDDGKGFC--HSLGYENFYAVLVTYSKALGSMGA-----ALLSSSEVkq 229
                        250       260
                 ....*....|....*....|....*...
gi 18419845  337 ---LSSSGYVFSASLPPYLASAAITAID 361
Cdd:PRK05937 230 dlmLNSPPLRYSTGLPPHALISIQVAYD 257
PLN02955 PLN02955
8-amino-7-oxononanoate synthase
109-471 5.52e-18

8-amino-7-oxononanoate synthase


Pssm-ID: 178541  Cd Length: 476  Bit Score: 86.27  E-value: 5.52e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  109 KDVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCETRISKFLGTPDSILYSYGLSTMFSTIPC 188
Cdd:PLN02955 102 KKLLLFSGNDYLGLSSHPTISNAAANAAKEYGMGPKGSALICGYTTYHRLLESSLADLKKKEDCLVCPTGFAANMAAMVA 181
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  189 FCKKGDVIVA------DEGV--------HWGIQNGLQLSR----STIVYFKHNDMESLRITLEKIMTKykrsknlRRYIV 250
Cdd:PLN02955 182 IGSVASLLAAsgkplkNEKVaifsdalnHASIIDGVRLAErqgnVEVFVYRHCDMYHLNSLLSSCKMK-------RKVVV 254
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  251 AEAVYQNSGQIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLAEHHSVPIEkIDVVTAAMGHALATEGGFCTGNAR 330
Cdd:PLN02955 255 TDSLFSMDGDFAPMEELSQLRKKYGFLLVIDDAHGTFVCGENGGGVAEEFNCEAD-VDLCVGTLSKAAGCHGGFIACSKK 333
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  331 IidYQRLSSSG--YVFSASLPPYLASAAITAIDVIDqnpdmlvKLKQNVALLWKGLSDIKGMSlTSNRESPIVFLKLeks 408
Cdd:PLN02955 334 W--KQLIQSRGrsFIFSTAIPVPMAAAAYAAVVVAR-------KEKWRRKAIWERVKEFKALS-GVDISSPIISLVV--- 400
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18419845  409 sGSAKDDLlllekMADRALKEDSLLVVSSKRSFL--DKCRLPVGIklyvSAGHSESDLLKASESL 471
Cdd:PLN02955 401 -GNQEKAL-----KASRYLLKSGFHVMAIRPPTVppNSCRLRVTL----SAAHTTEDVKKLITAL 455
PRK07505 PRK07505
hypothetical protein; Provisional
94-479 2.48e-15

hypothetical protein; Provisional


Pssm-ID: 181006  Cd Length: 402  Bit Score: 77.71  E-value: 2.48e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845   94 PVLESAAGPHTTVNGKDVVNFASANYLGLIGHEKLLESCTSALEKYGV-GSCGPRGFYGTiDVHLDCETRISKFLGtPDS 172
Cdd:PRK07505  31 TVGEREGILITLADGHTFVNFVSCSYLGLDTHPAIIEGAVDALKRTGSlHLSSSRTRVRS-QILKDLEEALSELFG-ASV 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  173 ILYSYGLSTMFSTIPCFCK------KGDVIVADEGVHWGIQN--GLQLSRSTIVYFKHNDMESLritlekimtKYKRSKN 244
Cdd:PRK07505 109 LTFTSCSAAHLGILPLLASghltggVPPHMVFDKNAHASLNIlkGICADETEVETIDHNDLDAL---------EDICKTN 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  245 LRRYIVAEAVYQNSGqIAPLDEIVKLKEKYRFRVILDESNSFGVLGRSGRGLA-EHHSVPIEKIDVVTAAMGHALATEGG 323
Cdd:PRK07505 180 KTVAYVADGVYSMGG-IAPVKELLRLQEKYGLFLYIDDAHGLSIYGKNGEGYVrSELDYRLNERTIIAASLGKAFGASGG 258
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  324 FCT-GNARIIDYQRLSSSGYVFSASLP-----PYLASAAITAIDVIDQnpdMLVKLKQNVALLwkglsDikgmSLTSNRE 397
Cdd:PRK07505 259 VIMlGDAEQIELILRYAGPLAFSQSLNvaalgAILASAEIHLSEELDQ---LQQKLQNNIALF-----D----SLIPTEQ 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  398 S----PIVFLKLEKSSGSAKddllllekmADRALKEDSLLVvsSKRSFldkcrlPV------GIKLYVSAGHSESDLLKA 467
Cdd:PRK07505 327 SgsflPIRLIYIGDEDTAIK---------AAKQLLDRGFYT--SPVFF------PVvakgraGLRIMFRASHTNDEIKRL 389
                        410
                 ....*....|..
gi 18419845  468 SESLKRLASELL 479
Cdd:PRK07505 390 CSLLKEILDEGL 401
PRK08360 PRK08360
4-aminobutyrate aminotransferase; Provisional
249-365 1.46e-03

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 181401  Cd Length: 443  Bit Score: 40.91  E-value: 1.46e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845  249 IVAEAVYQNSGQIAP----LDEIVKLKEKYRFRVILDESNSFgvLGRSGRGLA-EHHSVpieKIDVVTaaMGHALAteGG 323
Cdd:PRK08360 208 LFAEPIQGDAGMIVPpedyFKKLKKILDEHGILLVVDEVQSG--LGRTGKWFAiEHFGV---EPDIIT--LGKPLG--GG 278
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 18419845  324 F----CTGNARIIDyqRLSSSGYVFSASLPPYLASAAITAIDVIDQ 365
Cdd:PRK08360 279 LpisaTIGRAEIMD--SLPPLAHAFTLSGNPVASAAALAVIEEIEE 322
AAT_I cd01494
Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP) ...
191-323 1.48e-03

Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. Structure and sequence analysis has revealed that the PLP dependent enzymes can be classified into four major groups of different evolutionary origin: aspartate aminotransferase superfamily (fold type I), tryptophan synthase beta superfamily (fold type II), alanine racemase superfamily (fold type III), and D-amino acid superfamily (fold type IV) and Glycogen phophorylase family (fold type V).


Pssm-ID: 99742  Cd Length: 170  Bit Score: 39.29  E-value: 1.48e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 191 KKGDVIVADEGVHWG-IQNGLQLSRSTIVYFKHNDMESLRITLeKIMTKYKRSKNLRrYIVAEAVYQNSGQIAPLDEIVK 269
Cdd:cd01494  39 GPGDEVIVDANGHGSrYWVAAELAGAKPVPVPVDDAGYGGLDV-AILEELKAKPNVA-LIVITPNTTSGGVLVPLKEIRK 116
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....
gi 18419845 270 LKEKYRFRVILDESNSFGvlgrsGRGLAEHHsVPIEKIDVVTAAMGHALATEGG 323
Cdd:cd01494 117 IAKEYGILLLVDAASAGG-----ASPAPGVL-IPEGGADVVTFSLHKNLGGEGG 164
HemL COG0001
Glutamate-1-semialdehyde aminotransferase [Coenzyme transport and metabolism];
212-479 2.89e-03

Glutamate-1-semialdehyde aminotransferase [Coenzyme transport and metabolism];


Pssm-ID: 223080  Cd Length: 432  Bit Score: 39.87  E-value: 2.89e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 212 LSRSTIVyFKHNDMESLRITLEKimtkykRSKNLRRYIVaEAVYQNSGQIAP----LDEIVKLKEKYRFRVILDES-NSF 286
Cdd:COG0001 175 VAKHTLV-LPYNDLEALEEAFEE------YGDDIAAVIV-EPVAGNMGVVPPepgfLEGLRELTEEHGALLIFDEViTGF 246
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 287 GVlgrSGRGLAEHHSVpieKIDVVTaaMGHALAteGGF----CTGNARIIDyqRLSSSGYVFSA-SLP--PYLASAAITA 359
Cdd:COG0001 247 RV---ALGGAQGYYGV---EPDLTT--LGKIIG--GGLpigaFGGRAEIME--QLAPLGPVYQAgTLSgnPLAMAAGLAT 314
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 360 IDVIDQNPDMLVKLKQNVALLWKGLSDI---KGMSLTSNRES---PIVFLKLEKSSGS--AKDDLLLLEKMADRALKEDS 431
Cdd:COG0001 315 LEELMTEEGVYERLDALGERLAEGLRAAaerHGIPLTVNRVGsmfGIFFTEEGVRNYAdaKRSDVERFAKFFHHLLNRGV 394
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 18419845 432 LLVVSSKRSfldkcrlpvgikLYVSAGHSESDLLKASESLKRLASELL 479
Cdd:COG0001 395 YLAPSQFEA------------GFLSTAHTEEDIDRTLEAADEAFKELA 430
AAT_like cd00609
Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent ...
163-435 9.57e-03

Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. The major groups in this CD corresponds to Aspartate aminotransferase a, b and c, Tyrosine, Alanine, Aromatic-amino-acid, Glutamine phenylpyruvate, 1-Aminocyclopropane-1-carboxylate synthase, Histidinol-phosphate, gene products of malY and cobC, Valine-pyruvate aminotransferase and Rhizopine catabolism regulatory protein.


Pssm-ID: 99734  Cd Length: 350  Bit Score: 38.09  E-value: 9.57e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 163 ISKFLG-------TPDSILYSYGLSTMFSTIP-CFCKKGDVIVADEGVHWGIQNGLQLSRSTIVYFKHNDMESLRITLEK 234
Cdd:cd00609  45 IAEWLGrrggvdvPPEEIVVTNGAQEALSLLLrALLNPGDEVLVPDPTYPGYEAAARLAGAEVVPVPLDEEGGFLLDLEL 124
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 235 IMTKYKRSknlrryivAEAVY----QN-SGQIAPLDE---IVKLKEKYRFRVILDEsnSFGVLGRSGrglAEHHSVPIEK 306
Cdd:cd00609 125 LEAAKTPK--------TKLLYlnnpNNpTGAVLSEEEleeLAELAKKHGILIISDE--AYAELVYDG---EPPPALALLD 191
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18419845 307 IDVVTAAMG-----HALATE-GGFCTGNARIIDYQRLSSSGYVFSAslPPYLASAAITAI--DVIDQNPDMLVKLKQNVA 378
Cdd:cd00609 192 AYERVIVLRsfsktFGLPGLrIGYLIAPPEELLERLKKLLPYTTSG--PSTLSQAAAAAAldDGEEHLEELRERYRRRRD 269
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 18419845 379 LLWKGLSDIKGMSLTSNRESPIVFLKLEKSSGsakddllllEKMADRALKEDSLLVV 435
Cdd:cd00609 270 ALLEALKELGPLVVVKPSGGFFLWLDLPEGDD---------EEFLERLLLEAGVVVR 317
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH