NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|17557190|ref|NP_505818|]
View 

Actin-2 [Caenorhabditis elegans]

Protein Classification

PTZ00281 family protein (domain architecture ID 10794356)

PTZ00281 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTZ00281 PTZ00281
actin; Provisional
1-376 0e+00

actin; Provisional


:

Pssm-ID: 173506  Cd Length: 376  Bit Score: 776.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 80
Cdd:PTZ00281   1 MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 160
Cdd:PTZ00281  81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  161 THTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS 240
Cdd:PTZ00281 161 SHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKS 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  241 YELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITA 320
Cdd:PTZ00281 241 YELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTA 320
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 17557190  321 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:PTZ00281 321 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
 
Name Accession Description Interval E-value
PTZ00281 PTZ00281
actin; Provisional
1-376 0e+00

actin; Provisional


Pssm-ID: 173506  Cd Length: 376  Bit Score: 776.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 80
Cdd:PTZ00281   1 MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 160
Cdd:PTZ00281  81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  161 THTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS 240
Cdd:PTZ00281 161 SHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKS 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  241 YELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITA 320
Cdd:PTZ00281 241 YELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTA 320
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 17557190  321 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:PTZ00281 321 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
ACTIN smart00268
Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
6-376 0e+00

Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily


Pssm-ID: 214592  Cd Length: 373  Bit Score: 661.65  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190      6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGmGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEK 85
Cdd:smart00268   1 VPAIVIDNGSGTIKAGFAGEDFPQVVFPSIVGRPKDGKGMVG-DAKDIFVGDEAQEKRGGLELKYPIENGIVENWDDMEK 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190     86 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVP 165
Cdd:smart00268  80 IWDYTFFNELRVEPEEHPVLLTEPPMNPKSNREKILEIMFETFNFPALYIAIQAVLSLYASGRTTGLVIDSGDGVTHVVP 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    166 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS---SSSLEKSYE 242
Cdd:smart00268 160 VVDGYVLPHAIKRIDIAGRDITDYLKELLSERGYQFNSSAEFEIVREIKEKLCYVAEDFEKEMKLAREsseSSKLEKTYE 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    243 LPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 322
Cdd:smart00268 240 LPDGNTIKVGNERFRIPEILFSPELIGLEQKGIHELVYESIQKCDIDVRKDLYENIVLSGGSTLIPGFGERLEKELKQLA 319
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....
gi 17557190    323 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:smart00268 320 PKKLKVKVIAPPERKYSVWLGGSILASLSTFEDMWITKKEYEESGSQIVERKCF 373
Actin pfam00022
Actin;
6-376 0e+00

Actin;


Pssm-ID: 306521  Cd Length: 367  Bit Score: 602.29  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190     6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVgmgqkDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEK 85
Cdd:pfam00022   1 VSAVVIDNGSGTTRAGYAGEDAPKAVIPSCVGRPRGRKVEA-----KYYVGDEALTYRPGMEVRSPMEDGIVVDWDAMEK 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    86 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVP 165
Cdd:pfam00022  76 IWEYVFKEELQVDPEEHPLLLTEPPWNPPANREKAAEIMFETFGVPALYLAKNAVLSAYASGRTTGLVVDSGAGVTSVVP 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   166 IYEGYALPHAILRLDLAGRDLTDYLMKILtergySFTTTAEREIVRDIKEKLCYVALDFEQEmaTAASSSSLEKSYELPD 245
Cdd:pfam00022 156 VHDGYVLQKAIRRSDLAGDDLTDYLRELL-----SFNTYAEREVVREIKESVCYVSDDPFGD--ETLSSSIPTRSYELPD 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   246 GQVITVGNERFRCPEALFQPSFLGMESA-------GIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEI 318
Cdd:pfam00022 229 GSTIILGAERFRVPEALFNPSLIGSESElppptavGIPELIVDAINACDVDLRPELLANIVVTGGNTLFPGFTERLEREL 308
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 17557190   319 TALAPSTMKIKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:pfam00022 309 AQLAPPGVKVKIIAPPnERRYSAWIGGSILASLGTFQQMWVSKQEYEEHGASVVERKCK 367
COG5277 COG5277
Actin-related protein [Cytoskeleton];
1-376 5.18e-169

Actin-related protein [Cytoskeleton];


Pssm-ID: 227602  Cd Length: 444  Bit Score: 483.85  E-value: 5.18e-169
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIV 77
Cdd:COG5277   1 MTGDNVPTIVIDNGSGTTKAGFAGNDTPTTVFPSIVGRRRdEDSVMEDTEEKDTYVGNEAQNDRDNslLELRYPIENGII 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  78 TNWDDMEKIWHHTFYNE--LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--TGIV 153
Cdd:COG5277  81 LNWDAMEQIWDYTFFNKgdLLPSPEEHPLLLTEPPLNPPSNREKITELLFETLNVPALYLAIQAVLSLYASGSSdeTGLV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190 154 LDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE-----RGYSFTTT---AEREIVRDIKEKLC------- 218
Cdd:COG5277 161 IDSGDSVTHVIPVVDGIVLPKAVKRIDIGGRDITDYLKKLLREkyppsRGYNLKSElveYSSEIVNEIKEEVCetddesa 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190 219 YVALDFEQEMATA----------------ASSSSLEKSYELPDGQVITVGNE-RFRCPEALFQP---------------- 265
Cdd:COG5277 241 YVSLDAEEEFEEEeekpaekstestfqlsKETSIAKESKELPDGEEIEFGNEeRFKAPEILFKPelpisgleeagkides 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190 266 -------------SFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 332
Cdd:COG5277 321 kqelvaenyeispTNLGNDIAGLPELVYQSIQICDEDVRKSLYSNIVLTGGTSKIPGFAERLQKELTSLAPSIWKVSVIP 400
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....
gi 17557190 333 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:COG5277 401 PPDPSLDAWLGASILASLETFQQLWITKEEYEEHGPDILQEKRF 444
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
9-182 7.21e-20

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 86.49  E-value: 7.21e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   9 LVVDNGSGMCKAGFAGDDA---PRAVFPSIVGRPrhqgvmvgmgqkdsyvgdeaqskrgiltlkypiehGIVTNWDDMEK 85
Cdd:cd00012   1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  86 IWHHTFYNELRVAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNTPAMYVAIQAVLSLYASGRT-----T 150
Cdd:cd00012  46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                       170       180       190
                ....*....|....*....|....*....|..
gi 17557190 151 GIVLDSGDGVTHTVPIYEGYALPHAILRLDLA 182
Cdd:cd00012 126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
 
Name Accession Description Interval E-value
PTZ00281 PTZ00281
actin; Provisional
1-376 0e+00

actin; Provisional


Pssm-ID: 173506  Cd Length: 376  Bit Score: 776.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 80
Cdd:PTZ00281   1 MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 160
Cdd:PTZ00281  81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  161 THTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS 240
Cdd:PTZ00281 161 SHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKS 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  241 YELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITA 320
Cdd:PTZ00281 241 YELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTA 320
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 17557190  321 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:PTZ00281 321 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
PTZ00004 PTZ00004
actin-2; Provisional
1-376 0e+00

actin-2; Provisional


Pssm-ID: 240225  Cd Length: 378  Bit Score: 716.16  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 80
Cdd:PTZ00004   1 MSVEETNAAVVDNGSGMVKAGFAGDDAPRCVFPSIVGRPKNPGIMVGMEEKDCYVGDEAQDKRGILTLKYPIEHGIVTNW 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 160
Cdd:PTZ00004  81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETHNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  161 THTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL-EK 239
Cdd:PTZ00004 161 SHTVPIYEGYSLPHAIHRLDVAGRDLTEYMMKILHERGTTFTTTAEKEIVRDIKEKLCYIALDFDEEMGNSAGSSDKyEE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  240 SYELPDGQVITVGNERFRCPEALFQPSFLGMESA-GIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEI 318
Cdd:PTZ00004 241 SYELPDGTIITVGSERFRCPEALFQPSLIGKEEPpGIHELTFQSINKCDIDIRKDLYGNIVLSGGTTMYRGLPERLTKEL 320
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 17557190  319 TALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:PTZ00004 321 TTLAPSTMKIKVVAPPERKYSVWIGGSILSSLPTFQQMWVTKEEYDESGPSIVHRKCF 378
ACTIN smart00268
Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
6-376 0e+00

Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily


Pssm-ID: 214592  Cd Length: 373  Bit Score: 661.65  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190      6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGmGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEK 85
Cdd:smart00268   1 VPAIVIDNGSGTIKAGFAGEDFPQVVFPSIVGRPKDGKGMVG-DAKDIFVGDEAQEKRGGLELKYPIENGIVENWDDMEK 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190     86 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVP 165
Cdd:smart00268  80 IWDYTFFNELRVEPEEHPVLLTEPPMNPKSNREKILEIMFETFNFPALYIAIQAVLSLYASGRTTGLVIDSGDGVTHVVP 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    166 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS---SSSLEKSYE 242
Cdd:smart00268 160 VVDGYVLPHAIKRIDIAGRDITDYLKELLSERGYQFNSSAEFEIVREIKEKLCYVAEDFEKEMKLAREsseSSKLEKTYE 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    243 LPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 322
Cdd:smart00268 240 LPDGNTIKVGNERFRIPEILFSPELIGLEQKGIHELVYESIQKCDIDVRKDLYENIVLSGGSTLIPGFGERLEKELKQLA 319
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....
gi 17557190    323 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:smart00268 320 PKKLKVKVIAPPERKYSVWLGGSILASLSTFEDMWITKKEYEESGSQIVERKCF 373
Actin pfam00022
Actin;
6-376 0e+00

Actin;


Pssm-ID: 306521  Cd Length: 367  Bit Score: 602.29  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190     6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVgmgqkDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEK 85
Cdd:pfam00022   1 VSAVVIDNGSGTTRAGYAGEDAPKAVIPSCVGRPRGRKVEA-----KYYVGDEALTYRPGMEVRSPMEDGIVVDWDAMEK 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    86 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVP 165
Cdd:pfam00022  76 IWEYVFKEELQVDPEEHPLLLTEPPWNPPANREKAAEIMFETFGVPALYLAKNAVLSAYASGRTTGLVVDSGAGVTSVVP 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   166 IYEGYALPHAILRLDLAGRDLTDYLMKILtergySFTTTAEREIVRDIKEKLCYVALDFEQEmaTAASSSSLEKSYELPD 245
Cdd:pfam00022 156 VHDGYVLQKAIRRSDLAGDDLTDYLRELL-----SFNTYAEREVVREIKESVCYVSDDPFGD--ETLSSSIPTRSYELPD 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   246 GQVITVGNERFRCPEALFQPSFLGMESA-------GIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEI 318
Cdd:pfam00022 229 GSTIILGAERFRVPEALFNPSLIGSESElppptavGIPELIVDAINACDVDLRPELLANIVVTGGNTLFPGFTERLEREL 308
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 17557190   319 TALAPSTMKIKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:pfam00022 309 AQLAPPGVKVKIIAPPnERRYSAWIGGSILASLGTFQQMWVSKQEYEEHGASVVERKCK 367
PTZ00466 PTZ00466
actin-like protein; Provisional
9-376 1.94e-176

actin-like protein; Provisional


Pssm-ID: 240426  Cd Length: 380  Bit Score: 500.24  E-value: 1.94e-176
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWH 88
Cdd:PTZ00466  15 IIIDNGTGYIKAGFAGEDVPNLVFPSYVGRPKYKRVMAGAVEGNIFVGNKAEEYRGLLKVTYPINHGIIENWNDMENIWI 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   89 HTfYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYE 168
Cdd:PTZ00466  95 HV-YNSMKINSEEHPVLLTEAPLNPQKNKEKIAEVFFETFNVPALFISIQAILSLYSCGKTNGTVLDCGDGVCHCVSIYE 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  169 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSlEKSYELPDGQV 248
Cdd:PTZ00466 174 GYSITNTITRTDVAGRDITTYLGYLLRKNGHLFNTSAEMEVVKNMKENCCYVSFNMNKEKNSSEKALT-TLPYILPDGSQ 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  249 ITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 328
Cdd:PTZ00466 253 ILIGSERYRAPEVLFNPSILGLEYLGLSELIVTSITRADMDLRRTLYSHIVLSGGTTMFHGFGDRLLNEIRKFAPKDITI 332
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*...
gi 17557190  329 KIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:PTZ00466 333 RISAPPERKFSTFIGGSILASLATFKKIWISKQEFDEYGSVILHRKTF 380
PTZ00452 PTZ00452
actin; Provisional
8-376 5.54e-176

actin; Provisional


Pssm-ID: 185631  Cd Length: 375  Bit Score: 498.90  E-value: 5.54e-176
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIW 87
Cdd:PTZ00452   7 AVVIDNGSGYCKIGIAGDDAPTSCFPAIVGRSKQNDGIFSTFNKEYYVGEEAQAKRGVLAIKEPIQNGIINSWDDIEIIW 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   88 HHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIY 167
Cdd:PTZ00452  87 HHAFYNELCMSPEDQPVFMTDAPMNSKFNRERMTQIMFETFNTPCLYISNEAVLSLYTSGKTIGLVVDSGEGVTHCVPVF 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  168 EGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQ 247
Cdd:PTZ00452 167 EGHQIPQAITKINLAGRLCTDYLTQILQELGYSLTEPHQRIIVKNIKERLCYTALDPQDEKRIYKESNSQDSPYKLPDGN 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  248 VITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK 327
Cdd:PTZ00452 247 ILTIKSQKFRCSEILFQPKLIGLEVAGIHHLAYSSIKKCDLDLRQELCRNIVLSGGTTLFPGIANRLSNELTNLVPSQLK 326
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*....
gi 17557190  328 IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:PTZ00452 327 IQVAAPPDRRFSAWIGGSIQCTLSTQQPQWIKRQEYDEQGPSIVHRKCF 375
COG5277 COG5277
Actin-related protein [Cytoskeleton];
1-376 5.18e-169

Actin-related protein [Cytoskeleton];


Pssm-ID: 227602  Cd Length: 444  Bit Score: 483.85  E-value: 5.18e-169
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIV 77
Cdd:COG5277   1 MTGDNVPTIVIDNGSGTTKAGFAGNDTPTTVFPSIVGRRRdEDSVMEDTEEKDTYVGNEAQNDRDNslLELRYPIENGII 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  78 TNWDDMEKIWHHTFYNE--LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--TGIV 153
Cdd:COG5277  81 LNWDAMEQIWDYTFFNKgdLLPSPEEHPLLLTEPPLNPPSNREKITELLFETLNVPALYLAIQAVLSLYASGSSdeTGLV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190 154 LDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE-----RGYSFTTT---AEREIVRDIKEKLC------- 218
Cdd:COG5277 161 IDSGDSVTHVIPVVDGIVLPKAVKRIDIGGRDITDYLKKLLREkyppsRGYNLKSElveYSSEIVNEIKEEVCetddesa 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190 219 YVALDFEQEMATA----------------ASSSSLEKSYELPDGQVITVGNE-RFRCPEALFQP---------------- 265
Cdd:COG5277 241 YVSLDAEEEFEEEeekpaekstestfqlsKETSIAKESKELPDGEEIEFGNEeRFKAPEILFKPelpisgleeagkides 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190 266 -------------SFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 332
Cdd:COG5277 321 kqelvaenyeispTNLGNDIAGLPELVYQSIQICDEDVRKSLYSNIVLTGGTSKIPGFAERLQKELTSLAPSIWKVSVIP 400
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....
gi 17557190 333 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
Cdd:COG5277 401 PPDPSLDAWLGASILASLETFQQLWITKEEYEEHGPDILQEKRF 444
PTZ00280 PTZ00280
Actin-related protein 3; Provisional
8-373 1.55e-122

Actin-related protein 3; Provisional


Pssm-ID: 240343  Cd Length: 414  Bit Score: 364.05  E-value: 1.55e-122
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190    8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDME 84
Cdd:PTZ00280   6 VVVIDNGTGYTKMGYAGNTEPTYIIPTLIADNSKQSRRRskkGFEDLDFYIGDEALAASKSYTLTYPMKHGIVEDWDLME 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   85 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS----------GRTTGIVL 154
Cdd:PTZ00280  86 KFWEQCIFKYLRCEPEEHYFILTEPPMNPPENREYTAEIMFETFNVKGLYIAVQAVLALRASwtskkakelgGTLTGTVI 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  155 DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT---- 230
Cdd:PTZ00280 166 DSGDGVTHVIPVVDGYVIGSSIKHIPLAGRDITNFIQQMLRERGEPIPAEDILLLAQRIKEKYCYVAPDIAKEFEKydsd 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  231 --------AASSSSLEKSYElpdgqvITVGNERFRCPEALFQPSFLGME-SAGIHETSYNSIMKCDIDIRKDLYANTVLS 301
Cdd:PTZ00280 246 pknhfkkyTAVNSVTKKPYT------VDVGYERFLGPEMFFHPEIFSSEwTTPLPEVVDDAIQSCPIDCRRPLYKNIVLS 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  302 GGTTMYPGIADRMQKEITA----------------LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 365
Cdd:PTZ00280 320 GGSTMFKGFDKRLQRDVRKrvdrrlkkaeelsggkLKPIPIDVNVVSHPRQRYAVWYGGSMLASSPEFEKVCHTKAEYDE 399

                 ....*...
gi 17557190  366 SGPSIVHR 373
Cdd:PTZ00280 400 YGPSICRY 407
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
9-182 7.21e-20

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 86.49  E-value: 7.21e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190   9 LVVDNGSGMCKAGFAGDDA---PRAVFPSIVGRPrhqgvmvgmgqkdsyvgdeaqskrgiltlkypiehGIVTNWDDMEK 85
Cdd:cd00012   1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17557190  86 IWHHTFYNELRVAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNTPAMYVAIQAVLSLYASGRT-----T 150
Cdd:cd00012  46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                       170       180       190
                ....*....|....*....|....*....|..
gi 17557190 151 GIVLDSGDGVTHTVPIYEGYALPHAILRLDLA 182
Cdd:cd00012 126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH